KEGG   Serratia marcescens FGI94: D781_2301Help
Entry
D781_2301         CDS       T02433                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00625  Chloroalkane and chloroalkene degradation
smaf00680  Methane metabolism
smaf01100  Metabolic pathways
smaf01120  Microbial metabolism in diverse environments
smaf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    D781_2301
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D781_2301
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     D781_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AGB82569
UniProt: L0MF75
Position
2440344..2441531
Genome map
AA seq 395 aa AA seqDB search
MGHSSNRGVVYQGPGKVEVMDIDEPKFVSPSGKKIDHAVILKVLSTNICGSDQHMVRGRT
TAPAGMVLGHEITGEIIEKGSDVEMLNVGDIVSVPFNVACGRCRCCRELDTGVCLTVNPA
RAGGAFGYVDMGGWVGGQAKYVMVPYADFNLLKFPDRDQALAKILDLTMLSDILPTGFHG
AITAGVGVGSVTYVAGAGPVGLAAAASAQILGSAVVMVGDFNKERLAHAERMGFVPIDLG
KHDRLGEMIAEVVGVPEVDSAIDAVGFEAKGHSGKEQPAVVLNSMMDITRVAGNIGIPGL
YVTDDPGAHEQAAREGSLSLKFGLGWSKAQTFHTGQTPVLRYNRQLMNAILHDRLPIAKI
VNAKVIPLESAAEGYASFDAGVAAKYVLDPHGILA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggacactcatcaaacagaggcgttgtataccaggggccgggcaaagtggaagtgatg
gatattgatgaaccaaaattcgtcagcccatcgggcaagaaaatcgaccacgccgttatt
cttaaagtcctgtctaccaacatttgcggttccgaccagcatatggttcgcggccgcacc
accgcaccggccggcatggtgctggggcatgaaatcaccggggaaatcatagagaaaggc
tccgacgttgagatgcttaacgtcggcgatatcgtctccgtccccttcaacgtggcgtgc
ggccgctgccgctgctgccgtgagctggataccggcgtgtgcctgaccgttaacccggca
cgcgcgggcggcgccttcggctatgtggatatgggcggctgggtcggcgggcaggccaag
tacgtgatggtgccatatgccgatttcaacctgctgaaattccctgacagagaccaggcg
ctggcgaaaattctcgatctgaccatgctgtcagatatcctgccgaccggcttccacggc
gcgatcaccgccggcgtgggcgtcggttctgtcacctatgttgccggcgccggtcccgta
ggcctggcggccgcggcctccgcgcagatcctgggttctgcggtggtgatggttggcgac
ttcaataaagagcgtctggcgcatgccgaaagaatgggctttgtgccgatcgatttaggc
aaacacgatcggcttggcgagatgatcgccgaggtggttggcgtaccggaagttgactcg
gccattgatgcggtcggttttgaagccaaggggcactcgggcaaagaacagcccgcggtg
gtattaaacagcatgatggatatcacccgcgtggccggcaatatcggcatcccggggctg
tacgtcaccgatgacccgggcgcccatgagcaggccgcgcgcgaaggttcgctgagcctg
aagtttggcctcggctggtccaaggcgcagaccttccataccgggcagacgccggtatta
cgctataaccggcagctgatgaatgcgatcttgcatgaccgtctgcccatcgccaagatt
gtcaatgccaaggtgattccgctggaaagcgccgccgaaggctatgccagctttgatgcc
ggcgtggcggcaaaatacgtgctggatcctcacggaatcctcgcttaa

DBGET integrated database retrieval system