KEGG   Serratia marcescens FGI94: D781_2363Help
Entry
D781_2363         CDS       T02433                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
smaf  Serratia marcescens FGI94
Brite
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     D781_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2502312..2503682
Genome map
AA seq 456 aa AA seqDB search
MKKIILGCAILAIAGYLGIVGYIYHYDQQRQPATADSDINTILTKHGCDYCHTQSAELPF
YASLPVAKQLMQYDIKTGSRHFDLNPTLNALRQDGAVPEVDLAKMEAVLQSGEMPPLRYK
AVHWSGELGDADRQTLLNWIRAQRERFYTRPGTPEALRGQALQPLPESLPTDAQKVALGF
RLFHDPRLSADNSISCAHCHQLGAGGVDGRVTSLGVNDQHGPINAPTVFNAALNFSQFWD
GRAADLQQQAGGPPLNPIEMASTSWEQIIGKLDQDARLKADFQRVYADGFSGDNITDAIA
EFEKTLLTPDSPFDRYLKGDDSALTAQQKRGYQLFRDNKCGTCHTGENLGGQSYEVMGLK
ADYFADRGNLTEADNGRYNVTKNEADRHRFKTPTLRNVALTAPYFHDGSVTSLHQAVKDM
LKYQVGVTLPDSDVDDLVALLDGMTGKYQPSAPPAN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattttggggtgtgcgatcctggcgatcgcggggtatcttggcatcgtc
ggttatatctatcactacgatcagcagcgtcagccggcaactgccgatagtgacatcaac
accattctcaccaaacacggctgcgattactgccacacccaatccgccgaactgcccttc
tacgccagcctgccggtggccaagcagctgatgcagtacgatatcaaaaccggttcgcgt
catttcgacctgaacccgaccctgaacgcgctgcgccaggacggtgcggtgccggaagtg
gacctggcgaaaatggaagcggtgctgcaaagcggcgaaatgccgccgctgcgttataaa
gcggtgcactggtccggtgagctgggcgatgccgaccggcagaccctgctgaactggatc
cgcgcccagcgtgaacgcttctatacgcgtccgggcacgccggaagcgctgcgcggtcag
gcgctgcagccgctgccggaatcgctgccgaccgacgcgcaaaaggtagcgctgggcttc
cgcctgttccacgacccgcgtctgtccgccgataacagcatctcctgcgcccactgtcac
caactgggcgccggcggcgttgacggccgcgtcacctcgctcggggtcaacgatcagcac
ggcccgatcaacgcgccgacggtgtttaacgccgcgctgaacttctctcagttctgggac
ggccgcgccgcggatttacagcagcaggccggcggaccgccgctcaacccgattgagatg
gcctccacctcctgggagcagattattggcaagctggaccaggacgcgcgcctgaaggcg
gatttccaacgcgtttacgccgacggtttctccggcgataacattaccgacgccatagcc
gagtttgaaaaaacgctgctgacgccggacagcccgttcgaccgctacctgaaaggcgac
gacagcgcgctgaccgcccagcaaaagcgcggttatcagctgttccgcgacaacaagtgc
ggcacctgtcataccggcgagaacctcggtggccagtcgtatgaagtgatgggcctgaaa
gccgactacttcgccgaccgcggcaacctgaccgaggccgacaacggtcgttacaacgtc
actaaaaatgaagccgatcgccaccgcttcaagacgccgaccctgcgcaacgtcgcgctg
accgccccgtacttccacgacggcagcgtcaccagcctgcaccaggcggtgaaggatatg
ctgaagtaccaggtcggcgtaacgctgcctgacagcgacgtcgacgacctggtcgcgctg
ctggacggcatgaccggcaaatatcagccgtcggccccgccggcgaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system