KEGG   Serratia marcescens FGI94: D781_2420Help
Entry
D781_2420         CDS       T02433                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
smaf  Serratia marcescens FGI94
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smaf01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:smaf00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2564347..2565708
Genome map
AA seq 453 aa AA seqDB search
MQETVLNKIVRDKAHWVAARQQQQPLDSFQHQLTPSKRSFYHALQGTRTAFILECKKASP
SKGLIREDFNPAEIAGVYKEYASAISVLTDEKYFQGSFDFLPLVSNAVSQPVLCKDFIID
PYQIYLARHYQADAILLMLSVLSDEQYRQLAAVAHSLEMGVLTEVISEEELQRAIALGAK
VVGINNRDLRDLSIDLDRTRTLAPQVPHGVTVISESGINNYGQIRELSRFANGFLIGSAL
MSEPDLHAAVRRVILGDNKVCGLTRPQDAAAAYQAGANYGGLIFVGRSPRYVDISRAREV
IAGAPLKYVGVFCDAQVDTVVQTVERLGLRAVQLHGAEDQDYISALRARLPAGCQIWKAL
SVKTQVPARNLQHVDRYLLDNGAGGTGQRFDWSVLHGETLDNVLLAGGLSADNCIEAAQL
GCAGLDFNSGVESEPGIKDAQRLSAVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtgctcaacaagattgttcgtgataaggcgcactgggtcgcagcacga
cagcaacagcagccgctggacagctttcagcaccagctgacgcccagcaaacgcagtttt
tatcatgcgctgcaaggcaccagaacggcgtttattctcgaatgcaagaaagcctcgccc
tccaaggggctgattcgggaagattttaatccggcggagatcgccggcgtgtataaagag
tacgcctcggccatttccgtactgaccgatgaaaagtacttccagggcagctttgacttc
ctgccgctggtcagcaacgccgtcagccagccggtattgtgcaaagactttatcatcgat
ccgtaccagatttacctggcgcgccactatcaggccgacgccattttgctgatgctttca
gtgctcagcgacgagcagtaccgccagctggcggccgtcgcgcacagcctggagatgggc
gtgctgaccgaagtgatcagcgaggaagagctgcagcgggcgattgcgctcggcgccaag
gtggtcggcatcaacaaccgcgatctgcgcgacctgagtatcgacctggaccgcacccgc
acgctggcgccgcaggtgccgcacggcgtcacggtgatcagcgaatccggcatcaataac
tacggccagatccgcgagctcagccgctttgccaacggttttctgatcggcagcgcgctg
atgtctgagccggatctgcacgcggcggtgcgccgcgtgatcctcggcgacaataaagtc
tgcggcctgacccgtccgcaggacgccgctgcggcctatcaggccggcgccaactatggc
gggctgatttttgtcggccgctcaccgcgttatgtggacatcagccgcgcgcgcgaagtg
atcgccggcgcgccgctgaaatacgtcggcgtgttctgcgacgcacaggtcgacaccgtg
gtgcagaccgttgaacgcctgggcctgcgcgccgtacagctgcacggcgccgaagatcag
gactatatcagcgccctgcgcgcacgcctgcccgccggctgccagatctggaaagccctg
agcgtcaaaacgcaggtgccggcgcgcaatctgcagcacgtcgaccgttacctgctggat
aacggcgccggcggcaccggccagcgcttcgactggagcgtactgcacggcgaaacgctg
gataacgtgctgctggccggcggcctgagcgccgacaactgtatcgaagccgcacagctc
ggctgcgccggtctggatttcaattccggggtagagagcgaacccggcatcaaagacgca
cagcgcctgagtgccgtcttccagactctgcgcgcgtattga

DBGET integrated database retrieval system