KEGG   Serratia marcescens FGI94: D781_2420Help
Entry
D781_2420         CDS       T02433                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01130  Biosynthesis of antibiotics
smaf01230  Biosynthesis of amino acids
Module
smaf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D781_2420
Enzymes [BR:smaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     D781_2420
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     D781_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AGB82685
UniProt: L0MIW5
Position
2564347..2565708
Genome map
AA seq 453 aa AA seqDB search
MQETVLNKIVRDKAHWVAARQQQQPLDSFQHQLTPSKRSFYHALQGTRTAFILECKKASP
SKGLIREDFNPAEIAGVYKEYASAISVLTDEKYFQGSFDFLPLVSNAVSQPVLCKDFIID
PYQIYLARHYQADAILLMLSVLSDEQYRQLAAVAHSLEMGVLTEVISEEELQRAIALGAK
VVGINNRDLRDLSIDLDRTRTLAPQVPHGVTVISESGINNYGQIRELSRFANGFLIGSAL
MSEPDLHAAVRRVILGDNKVCGLTRPQDAAAAYQAGANYGGLIFVGRSPRYVDISRAREV
IAGAPLKYVGVFCDAQVDTVVQTVERLGLRAVQLHGAEDQDYISALRARLPAGCQIWKAL
SVKTQVPARNLQHVDRYLLDNGAGGTGQRFDWSVLHGETLDNVLLAGGLSADNCIEAAQL
GCAGLDFNSGVESEPGIKDAQRLSAVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtgctcaacaagattgttcgtgataaggcgcactgggtcgcagcacga
cagcaacagcagccgctggacagctttcagcaccagctgacgcccagcaaacgcagtttt
tatcatgcgctgcaaggcaccagaacggcgtttattctcgaatgcaagaaagcctcgccc
tccaaggggctgattcgggaagattttaatccggcggagatcgccggcgtgtataaagag
tacgcctcggccatttccgtactgaccgatgaaaagtacttccagggcagctttgacttc
ctgccgctggtcagcaacgccgtcagccagccggtattgtgcaaagactttatcatcgat
ccgtaccagatttacctggcgcgccactatcaggccgacgccattttgctgatgctttca
gtgctcagcgacgagcagtaccgccagctggcggccgtcgcgcacagcctggagatgggc
gtgctgaccgaagtgatcagcgaggaagagctgcagcgggcgattgcgctcggcgccaag
gtggtcggcatcaacaaccgcgatctgcgcgacctgagtatcgacctggaccgcacccgc
acgctggcgccgcaggtgccgcacggcgtcacggtgatcagcgaatccggcatcaataac
tacggccagatccgcgagctcagccgctttgccaacggttttctgatcggcagcgcgctg
atgtctgagccggatctgcacgcggcggtgcgccgcgtgatcctcggcgacaataaagtc
tgcggcctgacccgtccgcaggacgccgctgcggcctatcaggccggcgccaactatggc
gggctgatttttgtcggccgctcaccgcgttatgtggacatcagccgcgcgcgcgaagtg
atcgccggcgcgccgctgaaatacgtcggcgtgttctgcgacgcacaggtcgacaccgtg
gtgcagaccgttgaacgcctgggcctgcgcgccgtacagctgcacggcgccgaagatcag
gactatatcagcgccctgcgcgcacgcctgcccgccggctgccagatctggaaagccctg
agcgtcaaaacgcaggtgccggcgcgcaatctgcagcacgtcgaccgttacctgctggat
aacggcgccggcggcaccggccagcgcttcgactggagcgtactgcacggcgaaacgctg
gataacgtgctgctggccggcggcctgagcgccgacaactgtatcgaagccgcacagctc
ggctgcgccggtctggatttcaattccggggtagagagcgaacccggcatcaaagacgca
cagcgcctgagtgccgtcttccagactctgcgcgcgtattga

DBGET integrated database retrieval system