KEGG   Serratia marcescens FGI94: D781_2447Help
Entry
D781_2447         CDS       T02433                                 

Definition
alcohol dehydrogenase, class IV
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smaf  Serratia marcescens FGI94
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    D781_2447
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D781_2447
   00620 Pyruvate metabolism
    D781_2447
   00650 Butanoate metabolism
    D781_2447
  Lipid metabolism
   00071 Fatty acid degradation
    D781_2447
  Amino acid metabolism
   00350 Tyrosine metabolism
    D781_2447
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    D781_2447
   00626 Naphthalene degradation
    D781_2447
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     D781_2447
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     D781_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2592042..2594708
Genome map
AA seq 888 aa AA seqDB search
MAVTNIAELNELVARVKKAQREFANFTQEQVDAIFRAAALAAADARIPLAKMAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDQPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDESADIKRVVASILMSKTF
DSGVICASEQSVIVVDEVYNAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAAIVGQS
APKIAEMAGISVPANTKVLIGEVKLVDESEPFAHEKLSPTLAMYRAKDFADAVDKAEKLV
AMGGIGHTSCLYTDQDNQAERIAFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVAADGAK
RAFIVTDGYLFNNGYADQITSVLKSHGIETEVFFEVEADPTLSIVRKGAAQMNAFQPDVI
IALGGGSPMDAAKIMWVLYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDETGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEYLPVSYKEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLIANVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLAWLDELKTELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQIMLDTFYGREFSEAEETAKAPAAAKAEKKAKK
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacaaatatcgctgaattgaacgagcttgttgcacgtgtcaaaaaagcccag
cgcgagtttgccaacttcacccaggaacaggttgacgctatctttcgtgctgctgccctc
gccgctgccgatgcacgtattcccctggctaaaatggccgttgaagagtccggtatggga
atcgttgaagacaaggtgattaaaaaccactttgcttccgagtatatctacaacgcttat
aaagatgaaaaaacctgcggcgtgctgtctgaagacgacaccttcggcaccatcaccatc
gccgagcctatcggtattatctgcggcatcgtacccaccaccaacccgacctctacggcg
attttcaaggcgctgatcagcctgaaaacccgtaacggcattattttctcaccgcaccca
cgggccaagaacgccaccaataaagccgccgatatcgtgctgcaggcggcgatcgccgcc
ggcgcgccgaaagatatcatcggctggatcgatcagccttccgttgaactgtccaaccag
ctgatgcatcacccggatatcaacctgattctcgccaccggcggcccgggtatggtgaag
gcagcctacagctccggtaagccggccatcggcgtcggcgccggcaatactccggtggtg
gtcgatgaaagcgccgatatcaagcgcgtcgtcgcctctatcctgatgtcgaaaaccttc
gacagcggcgtgatctgcgcctcagaacagtccgtgatcgtcgtcgatgaagtgtataac
gcggtacgcgaacgtttcgcctcgcacggcggctacctgctgcagggcaaagagctgaag
gcggtgcaggatatcattctgaaaaacggcggcctgaacgcggccatcgtcgggcaatcc
gcgccaaaaatcgccgaaatggcgggcatcagcgtgccggccaacaccaaggtgctgatc
ggtgaagtcaagctggtagatgaatctgaacccttcgctcatgaaaaactctcgccgacg
ctcgccatgtaccgcgccaaagactttgccgacgccgtcgacaaggcggaaaaactggtg
gcaatgggcggtatcggccatacctcctgcctgtacaccgaccaggataaccaggcggag
cgcatcgccttcttcggcgacaagatgaaaaccgcccgtatcctgatcaatactccggcc
tcgcaagggggcatcggcgacctgtacaactttaagctggcgccttcgctgacgctgggc
tgcggctcatgggggggcaactccatctcggaaaacgtcggtccaaaacacttgatcaac
aagaaaaccgtagcgaagcgagcagaaaacatgttgtggcataaacttccgaaatctatc
tacttccgtcgcggctctctgcctatcgcgctggaagaagtggcggccgatggcgcgaag
cgcgcgtttattgtcaccgacggctacctgttcaataacggctatgccgaccaaatcacc
agcgtgctgaagtcccacggcatcgaaaccgaagtgttcttcgaagtagaagccgacccg
acgctgagcatcgtgcgtaaaggcgcagcgcagatgaacgccttccagccggacgtgatt
atcgcgctgggcggcggctcaccgatggatgcggcgaaaattatgtgggtgctgtatgaa
catccggaaacccacttcgaggatctggcgctgcgctttatggatatccgcaaacgcatc
tacaagttcccgaaaatgggcgtgaaggcaaaaatgatcgccgtcactactacctccggc
accggttctgaagtcacgccgttcgccgtggtaaccgatgatgaaaccggccagaaatat
ccgctggcggactatgccctgaccccggatatggcgattgtcgacgccaacctggtgatg
aatatgccgaaatcgctgtgcgccttcggcggcctggacgcggtaacccacgcgctggag
gcctatgtgtcagtactggcgaacgaatactccgacggccaggcgttgcaggcgctgaaa
ctgctgaaagagtatctgccggtcagttacaaggaaggcgcgaagaacccggtggcacgt
gagcgcgtgcataatgcggcgaccatcgccggcatcgccttcgccaacgccttcctcggg
gtgtgccactccatggcccacaaattggggtccgagttccatatcccacacggcctggcc
aacgccatgctgatcgccaacgtgattcgctataacgccaacgacaacccaaccaagcag
acggccttcagccagtacgaccgtccgcaggcgcgccgtcgttacgctgaaatcgccgat
cacctgggcctgagcgcgccgggcgaccgcaccgcacagaaaatcgagaaactgctggca
tggctggacgagctgaagaccgagctgggtatccctgcttccatccgtgaagcgggcgtg
caggaagccgatttcctggcgaaagttgataagctgtctgaagacgcgtttgacgaccag
tgcaccggcgccaatcctcgctatccgctgattgccgagctgaaacaaatcatgctggat
accttctacggtcgtgagttcagcgaagccgaagagacagcaaaagcaccggccgctgcc
aaagcggaaaagaaagccaaaaagtaa

DBGET integrated database retrieval system