KEGG   Serratia marcescens FGI94: D781_2452Help
Entry
D781_2452         CDS       T02433                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00040  Pentose and glucuronate interconversions
smaf00052  Galactose metabolism
smaf00500  Starch and sucrose metabolism
smaf00520  Amino sugar and nucleotide sugar metabolism
smaf01100  Metabolic pathways
smaf01130  Biosynthesis of antibiotics
Module
smaf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D781_2452
   00052 Galactose metabolism
    D781_2452
   00500 Starch and sucrose metabolism
    D781_2452
   00520 Amino sugar and nucleotide sugar metabolism
    D781_2452
Enzymes [BR:smaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     D781_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD DUF4833 CTP_transf_3 PHZA_PHZB
Motif
Other DBs
NCBI-ProteinID: AGB82717
UniProt: L0MHE4
Position
complement(2599156..2600073)
Genome map
AA seq 305 aa AA seqDB search
MSALNRKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPGVTVMQVRQGVAKGLGHAIM
CAYPLVGDEPVAVVLPDVILDEYSADLSKDNLHEMLTRFEQNGTSQIMVEPVPQESVGSY
GVADCKGYDLQPGESAPMVSVVEKPSPAQAPSNLAIVGRYVLSADIWALLAQTPPGAGDE
IQLTDAIDMLMRKEPVEAYHLKGKSHDCGNKLGYMQAFVEYGLRHASLGKEFSQWLQQFA
AAEKI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttaaatcggaaagtcagaaaagcagtgatcccggtggccggattaggcaca
cggatgttaccggcaacaaaagcgataccgaaagagatgctgccgctggtggataaacca
ctgattcaatacgttgttaatgaatgtattgccgcagggatcaacgaaatcgttctggtg
acgcactcctctaaaaattctatcgaaaaccattttgataccagctttgaactggaagcc
atgctggaaaaacgcgttaagcgccagctgcttgacgaggttcagtccatttgtccgccg
ggcgttaccgtgatgcaggtgcgtcaaggggttgccaaggggttgggccacgcgatcatg
tgcgcttatccgttagtcggcgatgagccggtggcagtggtgctgccggatgtcatcctg
gatgagtacagcgcggatctgagcaaagacaacctgcatgagatgctcacgcgtttcgaa
caaaacggcaccagccaaatcatggttgaaccagtgccgcaggaaagcgtcggtagttac
ggcgttgccgattgcaaaggctacgacctgcagccgggtgaaagtgcgccgatggtcagc
gtggtggaaaaaccgtctccggcgcaggcaccgtccaacctggcgatcgttgggcgttat
gtgctgtctgccgatatctgggcgctgctggcgcaaactccgccgggagcgggtgatgaa
atccaactgaccgacgctatcgatatgctgatgcgtaaagaaccggtagaagcttaccac
ctgaagggtaaaagccacgattgcggcaacaaactgggctatatgcaggcgtttgttgag
tacgggctgcgtcatgccagcctgggcaaggaattttcccagtggctgcagcagtttgct
gccgctgaaaagatctga

DBGET integrated database retrieval system