KEGG   Serratia marcescens FGI94: D781_2472Help
Entry
D781_2472         CDS       T02433                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
smaf  Serratia marcescens FGI94
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    D781_2472
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     D781_2472
    3.5.1.-  
     D781_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2615278..2615910
Genome map
AA seq 210 aa AA seqDB search
MNSALLLIDLQNDFCPGGALAVADGDAVIAVANQAIAACRDRGDWTIASQDWHPAQHRSF
AVNSSGRIGELGELEGLPQVWWPVHCVQESAGAEFHPRLQQRQIDAVFRKGQDPAIDSYS
AFFDNGHRAKTALDDWLRERNVSALTIMGLATDYCVKFSVLDALQLGYAVRVITDGCRGV
DLQPGDSEHALQAMQQAGAQLVTLSQFLQR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcgccctgttattgatcgatctgcaaaacgacttctgccccggcggcgcgctg
gcggtcgcggacggcgacgccgtcatcgcggtggctaaccaggcgattgccgcctgccgt
gaccgcggcgactggacgatcgccagccaggactggcacccggcgcagcatcgcagtttt
gccgtaaattcatcagggcggatcggggaactgggcgaactggagggactgccgcaggtc
tggtggccggtgcactgcgtgcaggaaagcgccggcgccgagtttcatccgcgcctgcag
cagcggcaaatcgatgcggtatttcgtaaaggacaggatccggccatcgacagctacagc
gcgttttttgataacggccaccgggcaaaaaccgcgctggatgactggctgcgggagcgc
aacgtcagcgcattgaccatcatggggctggcgaccgattactgcgtgaagttcagcgtg
ctggatgccctgcagctgggttatgccgtccgggtgattaccgacggctgccgcggcgtc
gatctgcagcccggcgacagcgaacatgcgctccaggcgatgcaacaggccggcgcgcaa
ttagtgaccttgtcacaattcctgcaacgctag

DBGET integrated database retrieval system