KEGG   Serratia marcescens FGI94: D781_2476Help
Entry
D781_2476         CDS       T02433                                 

Definition
aldose 1-epimerase-like enzyme
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
smaf  Serratia marcescens FGI94
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smaf00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2618182..2619057
Genome map
AA seq 291 aa AA seqDB search
MNEKVFTLPISKQISPYISQRQLDELSVVVVSHPKVRAAVTLQGAHLISWQPSGERPVIW
LSDNTPFKTGSAIRGGVPICWPWFGPAGKPSHGFARNQPWRLTAHDEDQDGVILTFTLQD
NEQTRKLWPHAFMLIARFKLGESCEIELESHGDYQATAALHSYFQIGDIARVSVAGLGET
YLDKVANGAEARQSGEVTFSGQTDRIYTQPAACSLIKDPALQRTIEVQHHHMSDVIAWNP
GAELSCSMADMANDGYKTMVCVETGRLSKPLLAQGEQPARLAVTFRCRKGA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaagttttcaccctgcccatcagcaagcagatctccccgtatatcagccag
cggcagctggacgaactgagcgtggtggtggtatctcaccccaaagtccgcgcggcggtg
acgctgcagggcgcgcatttaatcagctggcagccgagcggcgaacggcccgtcatctgg
ctgagcgataacaccccgtttaaaaccggcagtgccatccgcggcggcgtacccatctgc
tggccatggttcggcccggccggcaaaccgtcgcacggctttgcacgtaaccaaccctgg
cggctgaccgcccacgacgaagatcaggacggcgttatcctcacctttacgctgcaggat
aacgaacagacccgcaagctgtggccgcacgctttcatgctgatcgcccgcttcaagctg
ggggaaagttgtgagatcgagctggaatcacacggcgactatcaggctaccgcggcgctg
cacagctatttccaaatcggcgatatcgccagggtcagcgttgccgggctcggggaaacc
tatctggataaagtggccaacggcgccgaggcccgccagagcggcgaggtgaccttcagc
ggccagaccgaccgcatttacacccagccggcggcctgcagcctgatcaaggatccggcg
ctgcagcgcacgattgaagtgcagcaccaccatatgagcgatgtgatcgcctggaacccg
ggggcggagctatcctgcagcatggcggatatggccaacgacggctacaagaccatggtg
tgcgttgaaaccgggcggctcagcaagccgctgctggcgcagggcgaacagccggcccgt
ctggcggtcaccttccgctgccgcaaaggcgcctga

DBGET integrated database retrieval system