KEGG   Serratia marcescens FGI94: D781_2521Help
Entry
D781_2521         CDS       T02433                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
smaf  Serratia marcescens FGI94
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smaf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2666449..2667063)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGNILEKQPPLVLLEANGVGYEVHMPMTCFYELPELGQEAIVFTHFVVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVTTVEREEITALVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFANSSEINLPARAGKASEADIEAEAAAALVALGYKPQEASR
MVSKVAKPGADCETLIRDALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgtctcagagggaatatcctggaaaaacagccgccgctggtgttgctggaa
gcgaacggcgtcggttatgaagtgcatatgccgatgacctgcttctacgaactgccggaa
ctggggcaggaagcgatcgtatttacccattttgtggtgcgagaagacgcgcaactgctg
tatggttttaacgataagcaggagcgcgcgctgttccgcgagctgatcaaggttaacggc
gtggggccgaagctggcgctggcgatcctgtccggcatgtcggcgcagcagtttgtcacc
acggtagagcgtgaagaaattaccgcgctggtgaaattgccgggcgtgggcaaaaagacc
gccgagcgtctggtggtggaaatgaaagaccgctttaaaggactgaacggcgacctgttc
gccaacagcagcgaaatcaacctgccggcccgcgccggcaaggcgtccgaagcggatatc
gaagccgaggccgcggcggcgctggtggcgctggggtacaaaccgcaggaggccagccgc
atggtcagcaaggtcgccaagccgggcgccgattgcgaaaccctgatccgcgacgcgctg
cgcgcggccctgtaa

DBGET integrated database retrieval system