KEGG   Serratia marcescens FGI94: D781_2885Help
Entry
D781_2885         CDS       T02433                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00071  Fatty acid degradation
smaf00280  Valine, leucine and isoleucine degradation
smaf00281  Geraniol degradation
smaf00310  Lysine degradation
smaf00360  Phenylalanine metabolism
smaf00362  Benzoate degradation
smaf00380  Tryptophan metabolism
smaf00410  beta-Alanine metabolism
smaf00627  Aminobenzoate degradation
smaf00640  Propanoate metabolism
smaf00650  Butanoate metabolism
smaf00903  Limonene and pinene degradation
smaf00930  Caprolactam degradation
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01120  Microbial metabolism in diverse environments
smaf01130  Biosynthesis of antibiotics
smaf01212  Fatty acid metabolism
Module
smaf_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    D781_2885
   00650 Butanoate metabolism
    D781_2885
  Lipid metabolism
   00071 Fatty acid degradation
    D781_2885
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D781_2885
   00310 Lysine degradation
    D781_2885
   00360 Phenylalanine metabolism
    D781_2885
   00380 Tryptophan metabolism
    D781_2885
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D781_2885
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D781_2885
   00281 Geraniol degradation
    D781_2885
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D781_2885
   00627 Aminobenzoate degradation
    D781_2885
   00930 Caprolactam degradation
    D781_2885
Enzymes [BR:smaf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     D781_2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Tenui_N
Motif
Other DBs
NCBI-ProteinID: AGB83128
UniProt: L0MGV4
Position
3037100..3037873
Genome map
AA seq 257 aa AA seqDB search
MTTPWILHQQQGRVLTLTLHRPQARNALSTPCLQQLVERLEQAEADDDTGAVVIAGGARF
FAAGADLHELQQQDLPATLRDPRPLLWQRLAQFSKPLLAAVNGYALGAGCELALACDIVI
CGESARFGLPEITLGLMPGAGGTQRLIRCVGKSRASQMVLSGEAIDARLALQSGLVSEVC
VDALTLERTQQLAARIAQQAPLALRAAKQALRQADETGLTQGLAMERQQFAALAATEDRR
EGIAAFFEKRTPHYKGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccccctggatattgcatcagcagcagggccgcgtgctcaccctgacgctgcac
cgcccgcaggcgcgtaacgcgctcagcaccccctgcctgcaacagctggtcgaacggctg
gagcaggccgaggccgacgacgacaccggcgcggtggtgatcgccggcggcgcgcgcttt
tttgccgccggcgccgacctgcacgaactgcagcagcaggatctgcccgccaccctgcgc
gatccgcgtccgctgctgtggcagcggctggcccagttcagtaagccgctgctggcggcg
gtcaacggctatgcgctcggcgccggctgcgagctggcgctggcctgcgacatcgtgatc
tgcggcgaaagcgcccgtttcggcctgccggagatcaccctcggcctgatgccgggcgcc
ggcggcacccagcggctgattcgctgcgtcggcaagtcccgcgccagccagatggtgctg
agcggcgaagccatcgacgcccgtctggcgctgcagagcggactagtaagcgaagtctgc
gtcgacgcgctgacgctggagcgcacgcagcagctcgccgcgcgcatcgcgcagcaggcg
ccgctggcgctgcgcgccgccaaacaggcgctgcgtcaggccgatgaaaccgggctgacg
caggggctggccatggagcgccagcagtttgccgcgctggccgccacagaagatcgtcgt
gaaggcattgccgccttcttcgaaaaacgtaccccacactataaagggcgctga

DBGET integrated database retrieval system