KEGG   Serratia marcescens FGI94: D781_3556Help
Entry
D781_3556         CDS       T02433                                 

Definition
DNA helicase/exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
smaf  Serratia marcescens FGI94
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smaf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3749157..3751022)
Genome map
AA seq 621 aa AA seqDB search
MMQLLQQAVALGVLRPLDVQFAQVVAGPERPDMLLAAACLSAEAGAGHVCLQLEQLLPET
LFGARQPELAQAVWQAAGQPDVEAWRALLLSSSAVSDGSLPTPLVLQQQRLYLQRMWQSE
GEVADFIGSDDTPQPIDPQRLRPILDRLFGEAEATPDWQKIAAAVAATRRIAVISGGPGT
GKTTTVAKLLAALVQLADGERLRIQLAAPTGKAAARLTESLGSASRRLGLTQQQLSLFPS
EAATLHRLLGAQPNSQRMRYHRGNPLHLDVLVVDEASMVDLPMMARLIAALPAHARVIFL
GDRDQLASVEAGAVLGDICRFAEQGYSEARAAQLSQLTGCALQGQPAQAAAAVRDSLCLL
RKSYRFDANSGIGQLAFAVNAGDVRGARAALDGRFGDVAGYPLAETADYQALLDACVAGY
RDYLTQVAAGVDAQQVLDAFGRFQVLCALREGPFGVSGLNERIETGLQRAGLIRRASGAA
GRWYRGRPVMIGRNDSALGLFNGDIGIALPDAAGELRVHFQLPDGSIKSVQPSRLPAHET
AYAMTVHKSQGSEFDHTVLVLPNHYLPVLTRELVYTAITRARQRLSLYAADKVLMSAIRT
PTQRRSGLAERLLLASDEQGR
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagctactacaacaggcggtcgcgcttggcgtgttgcgtccgttggacgtgcag
ttcgcccaggtggtcgccgggccggaacggccggatatgttgctggcggcggcctgcctc
agcgcggaagccggtgccggccacgtctgtctgcagctggagcaactgctgccggagaca
ttattcggcgcccgccagcctgagctggcgcaggcggtctggcaggccgccggtcagccg
gacgttgaggcgtggcgagccctgctgctgtcgtcatcggcggtcagcgacggcagcttg
ccgacgccgctggtgctgcagcagcagcgtctctacctgcagcgcatgtggcaaagcgaa
ggcgaggtggcggactttatcggcagtgacgatacgccacagcctatcgatccgcagcgt
ttacggccgatcctggatcgcctgtttggcgaggcggaagcgacgccggactggcagaaa
atcgccgccgccgttgccgctacgcggcgcattgcggtgatttccggcgggccgggcacc
ggcaaaaccaccacggtggcgaaactgctggcggcgctggtgcagctggccgatggtgaa
cggctgcgcattcagctcgccgcgccgaccgggaaagcggcggcgcgcctgaccgaatcg
ctcggcagcgccagccgccggctggggctgacgcagcagcagctgagcctgtttccttcc
gaagccgccacgctgcaccgcctgctgggcgcgcagccgaacagccagcgcatgcgttac
catcgcggtaacccgctgcatctggacgtgctggtggtggatgaggcgtcgatggtggat
ttaccgatgatggcgcggctgatcgccgccttgcccgcacatgccagagtgattttcctt
ggcgaccgcgatcagctggcctcggtggaggcgggcgcggtgctgggggatatttgccgc
tttgccgagcagggctacagcgaggcgcgtgcggcgcagctcagccagctgaccggctgt
gcgctgcaggggcagccggcgcaggcggctgcggcggtgcgcgatagcctgtgtttgctg
cgtaaaagctaccgttttgacgccaactcgggcattggacagctggcgttcgcggttaac
gccggcgatgtccggggcgcgcgtgcggcgctggacgggcgttttggcgacgtggccggc
tatccgctggcggagacggcggactatcaggcgctgctggatgcctgcgtggcgggctat
cgcgattacctgacgcaggtggccgccggcgttgatgcgcagcaggtgctggatgcattc
ggacgttttcaggtgctgtgcgccctgcgggaaggaccgttcggcgtcagcgggctgaat
gaacgcattgaaaccggcctgcagcgcgccggattgatccggcgtgcgtccggcgccgcg
gggcgttggtatcgggggcgtccggtgatgatcggccgcaacgacagcgcgctggggctg
tttaacggcgatatcggcattgccttgccggatgcggcaggggaattgcgcgttcacttt
caactgccggacggcagcatcaaatcggtgcagccaagccgcttaccggcgcatgaaacc
gcctatgcgatgacggtgcacaagtcgcagggatcggagtttgaccatacggtgctggtg
ctgcccaaccattatctgccggtgctgacgcgggaactggtgtataccgccattacccgc
gcgcgtcagcggctgtcgctgtacgctgccgataaggttttgatgagcgccatacgtacg
ccgacgcagcgccgcagcgggctggccgaacgcctgctgctggcgagcgatgaacagggg
cgctaa

DBGET integrated database retrieval system