KEGG   Serratia marcescens FGI94: D781_3780Help
Entry
D781_3780         CDS       T02433                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00220  Arginine biosynthesis
smaf00250  Alanine, aspartate and glutamate metabolism
smaf00471  D-Glutamine and D-glutamate metabolism
smaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D781_3780
   00220 Arginine biosynthesis
    D781_3780
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    D781_3780
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     D781_3780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AGB83980
UniProt: L0MMI4
Position
complement(3993867..3994790)
Genome map
AA seq 307 aa AA seqDB search
MVTALDNALLAEILQQVRPLIGGGKVADYIPALAEVPADRLGMAVCTVDGALYQAGDAAE
RFSIQSISKVLSLTLALTRYQESEIWQRVGKEPSGLPFNSLLQLEMEQGKPRNPFINPGA
LVVCDMLQTRLSAPKQRMLEVVRQLAGEDDLAYDARVARSEFEHSDRNAAIAYLMKSFGN
FENDVLTVLHTYFHYCALRMSCVELARSFVYLANNGRDLQGNTVISPLQARQINALMMTS
GMYDGAGEFAYRVGMPGKSGVGGGIVTIVPDEMAIVVWSPELDASGNSLAGTAALELLSQ
RIGRSIF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttggtaacagcattggataacgcgctgctggcggagattctgcagcaggtgcgtccgttg
atcggcggcggcaaggtcgctgactatattcccgcgctggcggaggtgccggcggatcgc
ttgggcatggccgtctgcaccgtcgacggcgcgctgtatcaggccggcgacgcggcggaa
cgcttctccatccagtcgatttccaaagtgctgagcctgacgctggcgctgacgcgttat
caggagagtgagatctggcagcgtgtgggcaaagagccttccggcctgccgttcaactcg
ctgctgcagctggaaatggagcagggcaagccgcgtaacccgtttatcaacccgggggcg
ctggtggtgtgtgatatgctgcagactcgtctgagtgcgccaaagcagcggatgcttgaa
gtggtgcgccagctggccggcgaagacgacctggcctatgacgcgcgcgtcgcccgctcc
gagtttgagcactccgaccgcaacgcggcgatcgcctatctgatgaagtcgttcggcaac
ttcgaaaatgacgtgctgaccgtgctgcatacctactttcactactgcgcgctgcgcatg
agctgcgttgagctggcgcgcagctttgtctatctggccaataacgggcgcgatctgcag
ggcaatacggtgatctccccgctgcaggcgcggcagatcaatgcgctgatgatgaccagc
ggcatgtacgacggcgccggcgagtttgcctaccgggtcggtatgccgggcaagtcaggc
gtcggcggtggcatcgtgacgatcgtgcccgacgagatggcgattgtcgtctggtcgccg
gagctggatgcttccggcaactcgctggcgggaactgcggcgctggaactgttgtctcaa
cgaattggtcgttcgattttttag

DBGET integrated database retrieval system