KEGG   Serratia marcescens FGI94: D781_3887Help
Entry
D781_3887         CDS       T02433                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smaf  Serratia marcescens FGI94
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smaf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4106157..4107662
Genome map
AA seq 501 aa AA seqDB search
MSATKNVIIALDEGTTNAKAVALDECGQVIAKFSQALSIQTPREGWVEQSGELLVEASLN
VLAQAVAHVGAEHVCALAISNQRETAIGWYRSNGKPLGAALSWQCSRTADFCDSLRRDHQ
AQPIKAATGLPIAPLFSGSKMRWLLESVPNGFALAEQGEICLGTIDSWLLWHLTAGEAFY
CDYSNASRTQLLNLHSGGWDEQMLAIFQIPAAALPAVKPSSGLFGHTKGLADIPDGIPIM
AMIGDSHAALFGHALGQPGCVKATYGTGSSVMAPVTSAQCDIQSLATTIAWHDGQRLVYG
LEGNIPHTGDAVAWMADSTGLSELPAAELAHELNTLPASVDSTLGVYFVPALTGLGAPWW
NEHARGVICGLSRGVKRAHLIRAALESVAYQIADVVAAMRQHNDFTLTALMVDGGPSKND
WLMQYQADLLGCPVMRSDIPELSAIGAALLARKAITHITDDELKNYLPVHGEFRPNMARH
GRLQKRWREWQSAVERTLYAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaacaaagaatgtcatcatcgcgcttgatgaaggcaccaccaatgccaaagcc
gtcgcgctggacgaatgcggccaggtcatcgccaagttttcacaggcgctctccattcag
acgccgcgggaaggctgggtagaacagtcgggggaattgctggtagaagcctcgctgaac
gtgctggcgcaggcggtggcacacgtcggcgcggagcatgtctgcgcgctggcgatcagc
aatcagcgtgaaaccgccatcggctggtatcgcagcaacggcaaaccgctcggcgcggcg
ctctcctggcaatgctcgcgcaccgcggatttttgcgacagcctgcggcgcgatcatcag
gcgcagccgattaaagcggcgaccggtctgcccattgctccgctgttttccggctctaaa
atgcgctggctgctggagtcggtgccaaacggctttgcactcgccgagcagggcgagatt
tgcctgggcaccatcgacagctggctgctctggcatctgaccgcgggcgaagccttttac
tgcgattactccaacgcctcgcgcacgcagctgctgaacctgcacagcggcggctgggat
gaacagatgctggccatcttccagatccccgccgccgcgctgccggcggtcaaaccctca
agtggcctgttcggccataccaaaggactggcggacattcccgacggtattccgatcatg
gcaatgatcggcgattcgcacgccgcgttattcggccacgcactgggacagcccggctgc
gtcaaagccacctacggcaccggctcgtccgtcatggcgccggtgacttccgcccaatgc
gacatccagtcgctcgccaccaccatcgcctggcatgacgggcagcggctggtctacggg
ctggagggcaatattccccacaccggcgacgccgtcgcctggatggccgacagcaccggc
ttaagtgagctgcccgccgcagagctggcccatgagctgaatacgttgccggcttcggtg
gattccaccctcggggtgtatttcgtaccggcactcaccggcctaggcgcgccgtggtgg
aacgagcacgccagaggcgtcatttgcgggctaagccgcggcgttaaacgcgcgcacctg
attcgcgcagcgctggaatcagtcgcctaccagattgccgacgtggtcgccgccatgcgc
caacataatgacttcacgctgacggcgctcatggtggacggcggccccagcaaaaacgac
tggctgatgcagtaccaggccgatctgctgggatgcccggttatgcgcagcgatatcccc
gaactttcggccatcggcgccgccctgctggcgcgcaaagccattacccatatcaccgat
gacgaactgaaaaactacctgccggtacacggcgagtttcgtcccaacatggcacgccac
ggccgcctgcaaaaacgctggcgcgagtggcagagcgcggtagagcgcaccctctacgca
tcttga

DBGET integrated database retrieval system