KEGG   Serratia marcescens FGI94: D781_3967Help
Entry
D781_3967         CDS       T02433                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00052  Galactose metabolism
smaf00500  Starch and sucrose metabolism
smaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    D781_3967
   00500 Starch and sucrose metabolism
    D781_3967
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     D781_3967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AGB84157
UniProt: L0MLE8
Position
4189661..4191070
Genome map
AA seq 469 aa AA seqDB search
MDALSLMKHTALALMQGQTRAAADPHRPLWHLAPSVGLLNDPNGFIQHNGVYHLFYQWNP
LACDHGRKCWGHWQSRDLLHWQHQPVALLPDACYDSHGCYSGSAVAADGKIMLVYTGNVK
FPDGSRTAYQCLAQEDERGEYRKLGPVLPLPDGYSGHVRDPKVWRHEQSWYMVLGARDLQ
DRGKVLLLRSADLRQWTLLGEIAGAHLNGLGDFGYMWECPDLFRLAGREVLICCPQGLAA
QSERYLNVYQAGYFVGELDYPAARFSHGDFHELDAGFEFYAPQTTLAEDGRRLLVGWMGV
PEQDEQLQPTTRYGWLHTMTCLRELTLRDGRLYQQPVAELQQLRGELTRWQGAADDAPPL
ALGSAELWLTPHGPFRAGFGDAMQLTWDGERLTLTRTNLHSGAAEHRYWRGDLRELQLLF
DRSSVEIFINRGAAVMSSRYFPATPPDLRLHGAASLALQYWPLRPCMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgctgagcctgatgaaacacaccgcgctggcgctgatgcagggccagacgcgc
gccgccgccgatcctcaccgcccgctgtggcacctggcgcccagcgtcgggctgctcaac
gatcccaacgggtttattcagcacaacggcgtgtaccacctgttttatcagtggaacccg
ctggcctgcgaccacggccgcaaatgctggggccactggcagtcccgcgatctgctgcac
tggcagcaccagccggtggcgctgctgcccgacgcctgctacgacagccacggctgctat
tccggctcggcggtggcggcggacggcaagatcatgctggtctataccggcaatgtgaaa
ttccccgacggttcgcgcaccgcctaccaatgtctggcgcaggaggatgagcgcggcgaa
taccgcaagctcggcccggtgctgccgctgcccgacggctacagcggccacgtgcgcgac
ccgaaggtctggcgccatgagcagagctggtacatggtgctgggtgcgcgcgacctgcag
gatcgcggcaaggtgctgctgttgcgctccgctgacctgcgtcagtggacactgctggga
gagatcgcgggcgcgcacctgaacggcctgggcgacttcggctatatgtgggagtgcccg
gatctgttccgccttgccgggcgcgaagtgctgatttgctgcccgcaggggctggcggcg
cagtcggagcgctatctcaacgtctatcaggccggttatttcgtcggcgagctggattac
ccggcggcacgcttcagccacggtgattttcacgagctggacgccggcttcgagttttat
gcgccgcaaaccacgctggcggaagacggccgccggctgctggtgggctggatgggggtg
ccggaacaggacgagcagctgcagccgacgacgcgctacggctggctgcacaccatgacc
tgcctgcgcgagctgacgctgcgcgacggccggctgtatcagcaaccggtcgccgaactg
cagcagctgcgcggggaactgacccgctggcagggggcggccgacgacgcgccgccgctg
gcgctcggcagcgccgaactgtggttaacgccgcacggcccgttccgcgccggcttcggc
gacgccatgcagctgacctgggacggcgaacgactgacgctgacgcgcactaacctgcac
agcggcgcggcggagcaccgctactggcgtggcgatctccgggagctgcagctgctgttt
gaccgctccagcgtggagatctttatcaaccgcggcgccgcagtgatgagctcgcgctac
ttccctgcaacgccgccagacctgcggctgcacggcgccgcgtcgctggcgctgcaatac
tggccgctgcggccatgcatgttagaataa

DBGET integrated database retrieval system