KEGG   Serratia marcescens FGI94: D781_4219Help
Entry
D781_4219         CDS       T02433                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00630  Glyoxylate and dicarboxylate metabolism
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01120  Microbial metabolism in diverse environments
smaf01200  Carbon metabolism
Module
smaf_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    D781_4219
Enzymes [BR:smaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     D781_4219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: AGB84404
UniProt: L0MKG9
Position
complement(4465165..4466472)
Genome map
AA seq 435 aa AA seqDB search
MTTSRSQQIQQLEQEWKSARWEGITRPYSAEDVINLRGSVNPVCTLAQNGAAKLWELLHG
GARKGYINCLGALTGGQALQQAKAGVEAVYLSGWQVAADANTASAMYPDQSLYPVDSVPA
VVERINNTFRRADQIQWANKIEPGSQGYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPYDREFVTGERTVEGFFRTQAGIEQAISRGLAYAPYADLVWCETSTPDLAAAR
RFAEAIHARFPGKLLAYNCSPSFNWKKNLDDQTIARFQEELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFESSSRGYTFASHQQEVGTGYFDRVTTVIQGGV
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctctcgtagccaacagattcaacaactggaacaggaatggaagtccgcacgc
tgggaaggcattacccgcccgtacagcgcggaagatgtcatcaatctgcgcggctcggta
aatccggtatgcacgctggcgcaaaacggcgccgccaaactgtgggagctgctgcacggc
ggtgcgcgcaagggctatatcaactgtctgggggcgctgaccggcggccaggcgctgcag
caggccaaagccggcgtggaagccgtgtatctgtccggctggcaggtggcggcggacgcc
aataccgcctccgccatgtacccggaccagtcgctgtacccggtcgattccgtgccggcg
gtggtggagcggattaacaataccttccgccgcgccgatcagatccagtgggcgaataaa
atcgagccgggcagtcaaggctatgttgactacttcctgccgatcgtcgccgatgcggaa
gcgggcttcggcggggtgctgaacgcctttgagctgatgaaggcgatgattgaggccggc
gccgccggggtacactttgaagaccagctggcggcggtgaagaaatgcggccatatgggc
ggcaaggtgctggtgccgacgcaggaagcgattcagaaactggtggcggcgcggctggcg
gccgacgtactcggcgtgccgacgctgctgattgcccgcaccgacgccgatgcggcggat
ctgctgacctcagactgcgatccttacgaccgcgagttcgtgaccggtgaacgcaccgtt
gaaggcttcttccgcacgcaggcggggattgaacaggcaatcagccgcgggctggcctat
gcgccttatgccgacctggtgtggtgtgaaacctcaacgccggatctggcggccgccaga
cgctttgccgaggcgattcacgcccgcttccccggcaagctgctggcctataactgttcg
ccgtcgttcaactggaaaaagaacctcgacgatcaaaccatcgcccgtttccaggaagag
ctgtcggcgatgggctacaaataccagtttattaccctggccggcatccacagcatgtgg
ttcaacatgtttgacctggcccatgcgtacgcgcagggcgagggcatgaagcactacgtg
gagaaagtgcagcagccggagtttgaatccagcagccgcggctataccttcgcctcgcac
cagcaggaagtgggaaccggctattttgaccgggtgaccacggtgatccagggcggcgtc
tcctcggttaccgcgctgaccggttccaccgaggagcagcagttctag

DBGET integrated database retrieval system