KEGG   Serratia marcescens FGI94: D781_4351Help
Entry
D781_4351         CDS       T02433                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smaf  Serratia marcescens FGI94
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D781_4351
Enzymes [BR:smaf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     D781_4351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4576007..4578094)
Genome map
AA seq 695 aa AA seqDB search
MDRNSIDQAAAQAGIMADYVNAHGQQQAITPEIKRALLAAMNSKAASADAAPLPPVKVFF
QRQPIVLPLAGSGEYGWELIREDGGRLQGRAGAGKTFTLPAGELPLGYHQLRLTQQQQSW
QCRLIIAPRRCYEPDALLTGKKLWGACVQLYTLRSDSNWGIGDFGDLRRMVAEVGERGGA
FVGLNPIHALYPADPDSASPYSPSSRRWLNVLYIDVNAVEDFQRSAAAQRWWRQATTRKR
LAAARDSEWVDYAAVTGLKLQGLRLAFSQFQTRAADDPQRQALRLFVAESGDSLYQQAVF
DALHAHLCEQDPALWGWPVWPSAYRQSDGEATAAFCRDHQEEVEFYLWLQWLAAVQFADC
FACCRQQQMPIGLYRDLAVGVAQGGAETWCDRELYCLQASVGAPPDILGPLGQNWGLPPM
DPHVMAARGYQPFIDLLRANMADCGALRIDHVMALLRLWWIPAGATADRGAYVKYPVDDL
LAVLALESQRQRCMVIGEDLGTVPLEIVSKLRDSGVYSYKVLYFERDDENRFRAPQAYPV
QAMATITTHDLPTLRGYWQGDDLRLGASLGLYPDAEVLAELYADRERAKQGLLDGLHHYG
CVPQKVGGKAARLAMSPLLNRGLQRYVADSASALLGLQPEDWLDMATPVNVPGTSTEYPN
WRRKLPQTLEEMFADRRVTLLLKDLDRRRRNGSVG
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaacagcatcgaccaggcggcggctcaggcgggcattatggccgactatgtc
aatgcccatggccagcagcaggccatcacgccggagatcaagcgcgccttgctggcggcg
atgaacagcaaggcggcgtcggccgacgccgcgccgctgccgccggtaaaagtgtttttc
cagcgtcagccgattgtcctgccgctggcgggcagcggcgagtatggctgggaattgatc
cgcgaagacggcggccggctgcaggggcgcgccggcgccggcaagacgttcaccttaccc
gccggcgaactgccgctcggctatcaccagctgcgcctgacgcagcagcagcagagttgg
cagtgccggctgattattgccccccgacgctgttatgagccggacgcgctgctgaccggc
aaaaagctgtggggcgcctgcgtgcagctgtatacgctgcgctccgacagcaactggggc
atcggcgatttcggcgacctgcggcggatggtggcggaggtgggcgaacgcggcggcgcg
ttcgtcgggcttaacccgattcatgcgctctatccggcggacccggacagcgccagcccg
tacagcccgtcgtcgcgacgctggctgaacgtgctgtatatcgacgtcaacgccgtggag
gatttccagcgtagcgccgcggcgcagcgctggtggcgtcaggcgacgacccgcaagcgg
ctggcggcggcgcgcgacagcgaatgggtcgactatgcggcggtgaccgggctaaagctg
caggggctgcggctggccttcagccagttccagacgcgggcggccgatgatccgcagcgt
caggcgctgcgcctgtttgtcgccgagagcggcgacagcctttatcagcaggcggtgttt
gacgcgctgcacgcccacctgtgcgaacaggatccggcgctgtggggctggccggtctgg
ccgtcggcgtaccgccagagcgacggcgaggcgacggcggcgttctgccgcgatcatcag
gaggaggtggaattctatctgtggctgcagtggctggccgcggtgcagtttgccgactgt
tttgcctgctgccgtcagcagcagatgccgatcggcctgtatcgcgatctggcggtcggc
gtggcgcagggcggggcggaaacctggtgcgaccgcgagctgtattgtctgcaggcgtcg
gttggcgcgccgccggatatcctcggcccgctggggcagaactgggggctgccgccgatg
gatccgcacgtgatggcggcgcgcggctatcagccgtttatcgacctgctgcgcgccaat
atggccgactgcggcgcgctgcgcatcgaccacgtgatggcgttgctgcgtctgtggtgg
atacccgccggcgcgactgccgaccgcggcgcctatgtcaaatacccggtggacgatctg
ctggcggtgctggcgctggagagccagcgtcagcgctgcatggtgatcggcgaagatttg
gggacggtgccgctggagatcgtcagcaagctgcgcgacagcggcgtgtactcttacaag
gtgctgtatttcgaacgggatgatgagaaccgtttccgcgcgccgcaggcctacccggtg
caggcgatggcgaccatcaccacccatgatttgccgacgctgcgcggctactggcagggg
gatgatttacggctgggcgcctcgctcggcctgtatccggacgccgaggtgctggcggag
ctgtacgccgatcgcgagcgggccaagcaggggctgctggacgggttgcaccactacggc
tgcgtgccgcagaaggtgggcggcaaggcggcgcgtctggcgatgagcccgctgctgaac
cggggattgcagcgctatgtggcggacagtgccagcgcgttgctcggcctgcagccggaa
gactggctggatatggcgacgccggtgaatgtgccgggcaccagcacggaatacccgaac
tggcgacgtaagctgccgcagacgctggaggagatgtttgccgatcggcgggtgacgctg
ttgctaaaagatctggaccgtcggcggcgcaacggttcggtggggtag

DBGET integrated database retrieval system