KEGG   Serratia marcescens FGI94: D781_4567Help
Entry
D781_4567         CDS       T02433                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smaf  Serratia marcescens FGI94
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D781_4567
Enzymes [BR:smaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     D781_4567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4811564..4812490)
Genome map
AA seq 308 aa AA seqDB search
METGKLVVLGSINADHILNIEQFPRPGETVIGKQYKVAFGGKGANQAVAAGRSGADIAFI
ACVGADDVGERVRRQLATDRVDTQSIEAIENCTTGVALIFVNGEGENVIGIDAGANAALT
PAYLARYQQRVSDADALLMQLESPLETVIAAARLAKQHQTRVILNPAPARELPDELLAML
DMITPNETEAERLTGIAVDSEQDAARAAQALHQKGIETVLITLGSRGVWLSERGEGKLVP
AFKVEAVDTIAAGDTFNGALLTALLEGKAMQDAVCFGHAAAAIAVTRPGAQPSVPWREEI
DAFLQRQE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggaaagctggtggttctgggcagtatcaatgccgaccatatccttaatatt
gagcaatttccccgtccgggcgaaacggtgatcgggaaacagtataaggtggcgttcggc
ggcaaaggggccaaccaggcggtggccgccggccgcagcggcgccgatattgcctttatt
gcctgcgtgggcgccgacgacgtcggcgaacgggtgcgccggcagttggcgaccgatcgt
gttgatacgcagtcgatagaagcgattgaaaactgcaccaccggcgtggcgttaattttc
gttaatggtgagggtgaaaacgtgatcggtattgatgccggcgccaatgcggcattaacg
ccggcatatctggcgcgctatcagcaacgggtgagcgatgccgacgccctgctgatgcag
cttgaatcaccgcttgagacggtgatcgccgccgcgcgtctggcaaaacagcaccagacg
cgggtgatcctcaacccggcgccggcgcgtgaactgccggatgaactgctggcgatgctg
gatatgatcaccccgaacgaaaccgaagcggagcgcttgaccggtattgcggtggacagt
gagcaggatgccgcacgtgcagcgcaggcgctgcaccagaaaggcatcgagacggtactg
atcactctcggcagccgcggcgtgtggttgagtgagcgcggtgagggcaaactggtgccg
gcctttaaggttgaagccgtcgacaccatcgccgccggcgatacctttaacggcgcgctg
ctgacggcgctgctggaaggcaaagcgatgcaggacgccgtatgcttcggccatgccgcc
gcggcgattgccgtgacgcgcccgggggcccagccttccgtgccgtggcgtgaagagatc
gacgcctttttgcagcggcaggagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system