KEGG   Serratia marcescens SM39: SM39_1548Help
Entry
SM39_1548         CDS       T03592                                 

Gene name
cscA
Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
smar  Serratia marcescens SM39
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smar00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SM39_1548 (cscA)
   00500 Starch and sucrose metabolism
    SM39_1548 (cscA)
Enzymes [BR:smar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SM39_1548 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1569430..1570872)
Genome map
AA seq 480 aa AA seqDB search
MNTALAQADHAVEALRAERRDEYYPQFHLAPPAGWINDPNGLICIDGVYHAFFQHHPYSE
HWGPMHWGHATSRDLIRWQHQPIALAPDAPYDKDGCFSGCAVDDNGVLTLIYTGHVWLGE
PGDDSQVREVQCLATSEDGIRFVKHGPVLAPPDGIQHFRDPKVWRENGEWWLVVGAKENG
LGQVRLYRSADLRAWRFDRVLAGALAAHQGYMWECPDFFPLGEQHLLLFSPQGLAAQGYR
YRNRFQSGYLLGHWRPDSDFRVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKVHRWAGALTLPRELTLAADGSVRMNPARELAALRRESHTFLAQTLTNQHLPLADDV
QELTLTLRPADNDAERYGLAIGNAARLFVDNQAHRLVLERFHDNPALCTCRSVPLPEGDT
LSLRIFIDRSSLEIFVNQGQACLTSRIYPTAGERHLSLFAEGGRAQFEPITGWRLASIWG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgccttagctcaagccgaccatgcggtcgaggccctgcgcgcagagcgccga
gacgaatactacccgcagttccatctcgcgccgcccgccggctggatcaacgatcccaac
ggcctgatctgtattgacggcgtctatcatgccttcttccagcatcacccctacagcgaa
cactgggggcccatgcactgggggcacgcgaccagccgcgatctgatccgctggcagcac
cagcccatcgccctggcgcccgatgcgccctatgacaaagacggttgtttttccggctgc
gccgtggatgacaacggcgtgctgacgctgatttacaccggccacgtgtggctgggcgag
cccggcgacgacagccaggtgcgggaagtgcaatgtctggccaccagcgaagatggcata
cgcttcgttaaacatgggccggtgctggccccgccggacggcattcagcatttccgcgat
ccgaaagtctggcgcgagaacggcgaatggtggctggtggtcggcgccaaagaaaacggt
ctcggccaggtgcgcctgtaccgttctgcagacctgcgcgcctggcgcttcgatcgggtg
ctggccggcgcgctggcggcgcatcaagggtatatgtgggaatgcccggatttcttcccg
ctgggggaacaacacctgttgctattttcgccgcaggggctggcggcacagggctaccgc
taccgcaatcgcttccagagcggctatctgctcggccactggcggccggacagcgacttc
agggtgacacagcccttctgcgagctggatgccgggcacgatttctatgcgccgcagacc
ttcaccgccgccgacggccgtcggctgctgtttgcctggatggatatgtgggaatccccg
atgcccagcaaagtgcaccgttgggccggcgccctcaccctgccgcgcgagctgacgctg
gctgccgacggcagcgtccgcatgaacccggcgcgtgaactggcggcgctgcgccgagaa
tcgcacacctttttggcacagacgctgaccaatcagcatctgccgctggcggacgacgtg
caggaactcaccctgacgttgagaccggccgacaacgacgccgagcgttacgggctggcc
atcgggaatgcggcgcgcctgttcgtcgacaatcaggcgcaccggctggtgctggaacgt
tttcatgacaaccccgccctgtgcacctgccgcagcgtgccgctgccggaaggtgacacc
ctgtcactacggatcttcattgaccgctcatcgctggagatcttcgtcaatcagggccag
gcctgcctgaccagccgcatctacccgacggcgggcgagcgccacctcagcctgttcgcc
gaaggcggccgggcacagttcgagcccatcacgggatggcggctggcaagcatctgggga
taa

DBGET integrated database retrieval system