KEGG   Streptococcus mitis: smi_0079Help
Entry
smi_0079          CDS       T01173                                 

Gene name
bgaC
Definition
beta-galactosidase 3 (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
smb  Streptococcus mitis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    smi_0079 (bgaC)
Enzymes [BR:smb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     smi_0079 (bgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84655..86442
Genome map
AA seq 595 aa AA seqDB search
MTRFDIRDDFYLDGKPFKILSGAIHYFRIPPEDWYHSLYNLKALGFNTVETYVAWNLHEP
REGEFHFEGALDLERFLQTAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTKNMRIRSSAP
AYIEAVGRYYDQLLSRLVPHLLDNGGNILMMQVENEYGSYGEDKAYLRAIRQLMEDRGVT
CPLFTSDGPWRATLKAGTLIEDDLFVTGNFGSKAPYNFSQMQEFFDEHGKKWPLMCMEFW
DGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGTNFGFMNGCSARGTLDLPQV
TSYDYDALLDEEGNPTAKYLAVKKMMATHFPEYPQLEPLYKESMKVDAIPLAEKVSLFET
LDSLSSPIESLYPQKMEELGQSYGYLLYRTEASWDAEEERLRIIDGRDRAQLFVDGQWIS
TQYQTEIGEDIFYQGQKEALSRIDILIENMGRVNYGHKFLADTQRKGIRTGVCKDLHFLL
NWKHYPLPLDNPEKIDFSKGWTEGQPAFYAYDFTVREPKDTYLDLSEFGKGVAFVNGRNI
GRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGEYKEEIHLTRKPTLKHIKGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatttgatattagggacgatttctatttagatgggaaaccgttcaagattttg
tccggcgccattcattattttaggattcctccagaagattggtatcattcactctacaac
ttgaaagcccttggctttaatacggtagagacttatgtagcttggaatttacatgagcct
cgtgagggtgagtttcattttgaaggagctctggatttggagcgatttctacagacagca
caagatttgggtctctacgctatcgttcgtccctctcccttcatctgtgcggagtgggaa
ttcggtggcttaccggcttggcttttaaccaagaatatgcggattcgctcatccgcccca
gcctatattgaagctgtcggtcgctactatgaccagctcttgtcacgattggttccacat
ttgttggacaatggtggcaatatccttatgatgcaggttgaaaatgagtatggttcttat
ggagaagataaggcttacctaagagcaattcgacagttgatggaagatcgtggcgtaacc
tgtccactctttacatcagatggtccatggcgagctactctgaaagctggaaccttaatc
gaagatgacctctttgtaacaggcaactttggttctaaggccccttacaacttttcacag
atgcaggaattctttgatgaacatggcaagaaatggccactcatgtgtatggagttctgg
gatggctggttcaatcgttggaaggaaccgattatcacacgggacccaaaagaattggca
gatgcagttcgagaagttttggaacaaggttccatcaatctatacatgtttcatggtggt
acaaattttggcttcatgaatggttgttcggctcgaggaactttggacctgccacaggtt
acatcttatgattatgatgcccttctggatgaagaaggaaatccaactgccaaatatttg
gcagtcaagaagatgatggcgacacatttcccagagtatccgcagttggaaccactctat
aaggaaagcatgaaagtggacgctattccacttgctgaaaaagtttccttgtttgaaacc
ttagatagcttgtccagtcctatagaaagtctctatcctcaaaagatggaggagctagga
caaagttatggctatcttctctatcgtactgaggcaagttgggatgcagaagaggaaaga
cttcgtatcattgatggacgtgaccgtgctcaactctttgtagatggtcaatggatttcc
actcaataccagacagagattggggaagatattttctatcaaggtcaaaaggaagcgcta
tctagaattgacatattgatagaaaatatggggcgtgtcaactatgggcataagttctta
gccgatacgcaacgtaagggaatccgaacaggagtttgtaaggatttgcacttcttacta
aactggaaacactatccactcccactggataatcctgagaaaattgatttttcaaaagga
tggacagaaggacaaccagccttttacgcttatgactttacagtccgagagccaaaagat
acttacctagacttgtctgagtttggtaagggggttgcctttgtcaatgggcggaacata
ggacgtttttggaacgtcggtccaaccctctcgctttatatccctcatagctatctcaag
gaaggtgccaaccgcatcattatctttgaaacagaaggtgaatataaagaagagattcat
ttaactcgtaaacctacactaaaacatataaagggggaaaacttatga

DBGET integrated database retrieval system