KEGG   Streptococcus mitis: smi_0134Help
Entry
smi_0134          CDS       T01173                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (amylomaltase) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smb  Streptococcus mitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    smi_0134 (malM)
Enzymes [BR:smb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     smi_0134 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138936..140453
Genome map
AA seq 505 aa AA seqDB search
MKKRQSGVLMHISSLPGAYGIGSFGKSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDLDILVEQGLLQASDLEGVDFGSDASEVDYAKIYYARRPLLEKAVKRFL
EVGDVKDFEKFAQDNQSWLELFAEYMAIKEHFDNLAWTEWPDADARARKASALESYREQL
ADKLVYHRVTQYFFFQQWLKLKAYANDNHIEIVGDMPIYVAEDSSDMWANPHLFKTDVNG
KATCIAGCPPDEFSATGQLWGNPIYDWEAMDKDGYKWWIERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSDTAAPGEWVKGPGYKLFAAVKEELGELNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPEDESIDSPHLAPANSVMYTGTHDNNTVLGWYRNEIDDATREYMARYTN
RKEYETVPHAMLRTVFSSVSFMAIATMQDLLELDEAARMNFPSTLGGNWSWRMTEDQLTP
AVEEGLLDLTTIYRRINENLVELKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgtgttgatgcacatttcttctcttccaggggcatacgga
atcggatcatttggtaaaagtgcttacgacttcgttgatttcttggttcgcacaaaacaa
cgttactggcaaatccttccactaggaacaactagttacggagactctccttaccaatct
ttctcagcctttgcaggaaacactcattttatcgatttagatatcttggtggaacaaggc
ttgttgcaagcaagtgaccttgaaggggttgactttggtagcgatgcgtctgaagttgac
tatgcgaaaatctactatgcacgtcgtcctcttctagaaaaagcggtaaaacgtttcttg
gaagtaggagatgttaaagattttgagaaatttgctcaagacaaccaatcatggcttgaa
ctctttgcagagtatatggctatcaaagagcattttgataatcttgcttggactgaatgg
ccagatgcagatgctcgtgctcgtaaagcttcagcacttgaaagctaccgtgagcaattg
gcagacaagttggtttaccaccgtgtgactcaatacttcttcttccaacaatggttgaaa
ttgaaagcttacgctaacgacaaccacatcgaaatcgttggagacatgccaatttacgta
gcggaagattcaagcgatatgtgggcaaatccacatctcttcaagacagatgtcaatggt
aaggctacttgcatcgcaggatgcccaccagatgaattttctgccactggtcagctttgg
ggtaacccaatctatgactgggaagcaatggacaaagatggctacaaatggtggattgag
cgcttgcgtgaaagcttcaaaatctacgacatcgttcgtattgaccacttccgtggcttc
gaatcttactgggaaatccctgctggttctgatacagcagcacctggtgagtgggtgaaa
ggtcctggttacaagctttttgcagccgttaaggaagaacttggtgagctaaacatcatc
gctgaagaccttggcttcatgactgatgaagttatcgaattgcgtgaacgtactggcttc
ccaggaatgaagattcttcaatttgccttcaacccagaagacgaaagcatcgatagccca
cacttggcacctgctaactcagttatgtacacaggaacacacgataacaatacggtcctt
ggttggtaccgtaacgagatcgatgatgcgactcgtgagtacatggcgcgctacacgaac
cgtaaagaatacgaaacagtgccacatgctatgcttcgtacagtcttttcatcagttagt
ttcatggcaattgcaactatgcaagatttgctagaattggatgaggcagctcgtatgaac
ttcccatctacccttggtggaaactggtcttggcgtatgactgaagatcaattgacacca
gctgtcgaggaaggcttgcttgacttgacaacaatttatcgccgaatcaatgagaatttg
gtagaattaaagaaataa

DBGET integrated database retrieval system