KEGG   Streptococcus mitis B6: smi_0147Help
Entry
smi_0147          CDS       T01173                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smb  Streptococcus mitis B6
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:smb00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smb00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smb00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smb00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(156618..157517)
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKHDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDDHAVPLTKQLMNDYESTHASTIAVMPVPHEEVSAYGVIAPQ
GEGINGLYSVETFVEKPAPEEAPSDLAIIGRYLLTPEIFEILENQAPGAGNEIQLTDAID
TLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKDYLIQLGKELAEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagtcatccctgccgctggactcgggactcgattttta
ccagcaaccaaagcacttgctaaagaaatgttgccaattgtggacaaaccaactatccaa
tttatcgtcgaagaagctcttaaatcaggtattgaagatattctggttgtcactggtaaa
tcaaaacgttctattgaagaccactttgactcaaactttgagcttgagtacaacctcaaa
gaaaaaggcaaacatgacttactaaaattggtagacgaaacaactggcattcgccttcac
tttatccgtcaaagccatcctcgtggtcttggtgatgctgtcttacaagcaaaagctttt
gtaggaaatgagcccttcgttgtcatgcttggtgatgacctaatggatatcacagatgac
cacgctgttcctttgacaaaacaattgatgaatgattacgagtcgactcatgcatcaaca
attgctgttatgcctgtccctcatgaagaagtttcagcatatggagttatcgcgcctcaa
ggcgaagggattaatggtctctacagcgtcgaaactttcgttgaaaaaccagctccagag
gaggcgccaagtgatctagctattatcggacgctatctgctcacaccagaaatttttgag
attctcgaaaatcaagctcccggtgctgggaatgaaatccaacttaccgatgcgattgat
acgcttaataaaacacaacgtgtttttgcccgtgaatttacaggagctcgttacgacgtt
ggagataaattcggctttatgaaaacatctattgactacgccctcaagcacccacaagtc
aaagatgacttgaaagattacctcatccaactgggaaaagaattagctgagaaggaataa

DBGET integrated database retrieval system