KEGG   Streptococcus mitis: smi_0147Help
Entry
smi_0147          CDS       T01173                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smb  Streptococcus mitis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    smi_0147 (galU)
   00052 Galactose metabolism
    smi_0147 (galU)
   00500 Starch and sucrose metabolism
    smi_0147 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    smi_0147 (galU)
Enzymes [BR:smb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     smi_0147 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(156618..157517)
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKHDLLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDDHAVPLTKQLMNDYESTHASTIAVMPVPHEEVSAYGVIAPQ
GEGINGLYSVETFVEKPAPEEAPSDLAIIGRYLLTPEIFEILENQAPGAGNEIQLTDAID
TLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKDYLIQLGKELAEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagtcatccctgccgctggactcgggactcgattttta
ccagcaaccaaagcacttgctaaagaaatgttgccaattgtggacaaaccaactatccaa
tttatcgtcgaagaagctcttaaatcaggtattgaagatattctggttgtcactggtaaa
tcaaaacgttctattgaagaccactttgactcaaactttgagcttgagtacaacctcaaa
gaaaaaggcaaacatgacttactaaaattggtagacgaaacaactggcattcgccttcac
tttatccgtcaaagccatcctcgtggtcttggtgatgctgtcttacaagcaaaagctttt
gtaggaaatgagcccttcgttgtcatgcttggtgatgacctaatggatatcacagatgac
cacgctgttcctttgacaaaacaattgatgaatgattacgagtcgactcatgcatcaaca
attgctgttatgcctgtccctcatgaagaagtttcagcatatggagttatcgcgcctcaa
ggcgaagggattaatggtctctacagcgtcgaaactttcgttgaaaaaccagctccagag
gaggcgccaagtgatctagctattatcggacgctatctgctcacaccagaaatttttgag
attctcgaaaatcaagctcccggtgctgggaatgaaatccaacttaccgatgcgattgat
acgcttaataaaacacaacgtgtttttgcccgtgaatttacaggagctcgttacgacgtt
ggagataaattcggctttatgaaaacatctattgactacgccctcaagcacccacaagtc
aaagatgacttgaaagattacctcatccaactgggaaaagaattagctgagaaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system