KEGG   Streptococcus mitis: smi_0193Help
Entry
smi_0193          CDS       T01173                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smb  Streptococcus mitis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    smi_0193 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    smi_0193 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    smi_0193 (thrC)
Enzymes [BR:smb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     smi_0193 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190951..192435
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPLTYPKVDLDFDKLKDASYQEVAKLVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQIGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLAANKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTAELMNALNKQGQYELT
DFDAEILNLFAAEYATEEETAAEIKRVYESDSYIEDPHTAVASAVYKKYQAATGDVTKTV
IASTASPYKFPVVAVEAVTGKVGLTDFEALAQLHDISGVAVPPAVDGLETAPVRHKTTVA
AADMQAEVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgacgccaacaatacagtaactgctagccaagca
attttgcaaggtttggcaacggatggtggtttgtttacaccgcttacttatccaaaggta
gatttggactttgacaaattgaaagatgcttcttatcaggaagttgctaagcttgttttg
tcagcatttttagatgactttacagctgaagagttggactactgtatcaacaatgcctac
gatagcaagtttgatactccagctatcgcaccattagtgaaattagatgggcaatacaat
ctggagcttttccatggttcaacaattgcttttaaggatatggccttgtctattttgcca
tactttatgacaacggctgctaagaagcatggtttggagaacaagattgtcatcttaaca
gcgacatctggtgatactgggaaagctgctatggcagggtttgcggatgttcctggtact
gagattatcgtcttttatccaaaggatggtgtcagcaaggtacaagagttgcaaatgacc
actcagattggcgacaatactcatgttatcgctattgatggtaactttgatgatgcccaa
actaatgtgaagcatatgtttaacgatgtggctcttcgtgagaagttggcagccaacaag
ttgcaattttcatcggctaactctatgaatattggccgtttggtgccacaaattgtctac
tatgtttatgcctacgctcagcttgttaaaactggtgagattgtagctggtgaaaaggtt
aacttcacggtaccgacaggaaactttggaaatatcttggctgccttttatgccaaacaa
atcggtctaccagttggcaaattaatctgtgcttcaaatgacaacaatgttttgacagac
ttcttcaagacacgtgtttacgacaagaagcgtgagtttaaggtaacaactagtccatct
atggatatcttggtatcttcaaacttagagcgtttgattttccatcttttgggtaatgat
gcggttaaaacagctgaactcatgaatgccttgaacaagcaaggacaatatgagttgaca
gactttgatgcagagattcttaacctctttgcagctgaatatgcgactgaggaagaaaca
gcggcagaaatcaagcgtgtttatgagtcagattcttatatcgaagatccacatacggcg
gttgcctcagcagtttataagaaataccaagctgctactggagatgtaactaagacagtg
attgcttcaacagctagtccatacaagttcccagtagttgcagtagaagctgtaacgggg
aaagttggcttgactgactttgaagccttggctcaattacatgatatttcaggagtggca
gtgccgccagcagttgatgggcttgaaacagctcctgttcgtcacaagacaactgtggcg
gctgcagatatgcaagcagaggttgaggcttatctaggactttaa

DBGET integrated database retrieval system