KEGG   Streptococcus mitis: smi_0203Help
Entry
smi_0203          CDS       T01173                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
smb  Streptococcus mitis
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    smi_0203 (adh)
Enzymes [BR:smb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     smi_0203 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203998..205056
Genome map
AA seq 352 aa AA seqDB search
MKAYTYVKPGLASFVDVDKPVIRKPTDAIVRIVKTTICGTDLHIIKGDVPACQSGTILGH
EGIGIVEEVGEGVSNFKKGDKVLISCVCACGKCYYCKKGIYAHCEDEGGWIFGHLIDGMQ
AEYLRVPHADNTLYHTPEDLSDEALVMLSDILPTGYEIGVLKGKVEPGCSVAIIGSGPVG
LAALLTAQFYSPAKLIMVDLDDNRLETAVSFGATHKVNSSDPEKAIKEIYDLTDGRGVDV
AIEAVGIPATFDFCQKIIGVDGTVANCGVHGKPVEFDLDKLWIRNINVTTGLVSTNTTPQ
LLKALESHKIEPEKLVTHYFKLSEIEKAYEVFSKAADHHAIKVIIENDISEA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctatacttatgttaaaccaggacttgcttcttttgttgatgtagacaaacca
gttattcgcaagccaacagacgctattgtgcgtatcgtaaaaaccactatttgtggaaca
gacctccatattatcaaaggggatgttcctgcttgccaaagtggtaccattcttggtcac
gaagggattgggattgttgaagaagttggggaaggagtttctaacttcaaaaaaggcgat
aaggtcttgatttcttgtgtctgtgcctgtggtaaatgctactactgtaaaaaaggaatt
tatgcccactgtgaagacgaaggtggctggattttcggtcacctgattgatggtatgcag
gctgaatatctacgtgtccctcatgcagataacactctttaccacactccagaagacttg
tcagatgaagccttggttatgttatcagacattctgcctactggatatgaaattggtgtt
ttgaaagggaaagtagaacctggttgtagcgtagccattattggttcaggtccagttgga
ttggctgctcttttaacagctcaattctattcaccagctaaattgattatggtggactta
gacgataaccgcttggaaactgctgtatcatttggtgcgactcacaaggttaattcttca
gaccctgaaaaagccattaaagaaatttatgatttgacagatggtcgtggtgtggatgtc
gctatcgaagctgttggtattcctgcaacatttgatttctgtcaaaagattatcggtgta
gacggaacggttgccaactgtggtgtgcatggtaaaccagttgaattcgatttagataaa
ctttggattcgcaacatcaatgtaacaactggtttggtatctacaaatacaactccacaa
ttgttgaaagcactcgaaagtcataagattgaaccagaaaaattggtaactcattatttc
aaattaagtgaaattgaaaaagcctatgaagtcttcagtaaggcagcagaccaccatgca
atcaaagtcattattgaaaacgatatttcagaagcttaa

DBGET integrated database retrieval system