KEGG   Streptococcus mitis: smi_0231Help
Entry
smi_0231          CDS       T01173                                 

Gene name
adhE
Definition
alcohol-acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smb  Streptococcus mitis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    smi_0231 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    smi_0231 (adhE)
   00620 Pyruvate metabolism
    smi_0231 (adhE)
   00650 Butanoate metabolism
    smi_0231 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    smi_0231 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    smi_0231 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    smi_0231 (adhE)
   00626 Naphthalene degradation
    smi_0231 (adhE)
Enzymes [BR:smb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     smi_0231 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     smi_0231 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226615..229266
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKKLAAEKHVDGLVQKALVALEEMRKLDQEQVDYIVAKASVAALDAHGEL
ALHAYEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKALISLKTRNPIVFAFHPSAQESSAHAAQIVRDAAIKAGAPENCVQW
ITEPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREKLSPV
IAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
NRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERVGIQMNFKAQGIDEKEWKEHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDSYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtgacaccagaggaaaagaaactcgctgctgaaaagcatgtc
gacggcttggtgcaaaaagctctagttgctcttgaggaaatgcgtaagttggaccaagag
caggttgactatatcgttgccaaagcatcagtagcagctttggatgcccacggggaattg
gctctacatgcctatgaagaaacaggacgtggtgtatttgaagacaaagcaactaagaac
ttgtttgcttgtgaacacgtagtaaacaacatgcgccacactaaaacagttggtgttatc
gaagaagacgatgtaacaggtttgactcttatcgctgaaccagttggcgttgtttgtggt
atcactccaacaacaaacccaacatcaacagcaatctttaaggcattgatttcattgaag
acacgtaatccaattgtctttgcattccacccatcagctcaagaatcatcagctcacgca
gctcaaatcgttcgtgatgctgcgattaaagcaggtgctcctgaaaactgtgtacagtgg
atcactgaaccatctatggaagcaactagtgcacttatgaaccacgaaggtgttgcaaca
atccttgcaactggtgggaatgccatggttaaagcggcatactcatgtggtaaaccagct
cttggagtaggtgccggaaacgttccagcttatgttgaaaagtcagcaaacattcgtcaa
gctgcacacgatatcgttatgtctaaatcatttgacaacggtatggtctgtgcatctgaa
caagcagttatcattgataaagaaatttacgatgaatttgtagcagagttcaaatcatat
cacacttactttgtaaacaaaaaagaaaaagcacttcttgaagaattctgcttcggcgtg
aaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatcgttggtaaacca
gcaacttggattgcagaacaagcaggatttacagttccagaaggaacaaacattcttgct
gcagaatgtaaagaagttggtgaaaatgagccattgacccgtgaaaaattgtcaccagtt
atcgcagttttgaaatctgaaagccgtgaagatggtattactaaggctcgtcaaatggtt
gaatttaacggtcttggacactcagcagctatccacacagctgacgaagaattgactaaa
gaatttggtaaagctgttaaagctattcgtgttatctgtaactcaccttctactttcggt
ggtatcggggacgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactcagttggggataacgttagtgccattaacctcttgaatatcaaaaaagtc
ggaagacggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatgatcgttactgac
catgccatggtcgagcttggtttccttgatcgtatcatcgaacaacttgatcttcgtcgc
aataaggttgtttaccaaatctttgcagatgtagaaccagatccagatatcacaactgta
aaccgtggtactgagattatgcgtgccttcaaaccagatacaatcatcgctcttggtggt
ggatctccaatggatgctgctaaagtaatgtggctcttctatgagcaaccagaagtggac
ttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttcaaattcccattg
cttggtaagaagactaaattcatcgcgattccaactacatctggtacagggtctgaagta
acaccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgtagaccctgctttggtattgacagttcctggattt
gttgctgcggacactggtatggacgtactgacccacgcgactgaagcttacgtatcacaa
atggctagcgactacactgacggtcttgcacttcaagccatcaaacttgtattcgaaaac
cttgaaagctcagttaagaatgcagacttccactcacgtgagaaaatgcataacgcttca
acaatcgctggtatggcctttgccaatgccttcctaggtatttctcactcaatggctcat
aagattggtgcgcaattccacacaatccatggtcgtacaaatgctatcttgcttccatac
gtcatccgctacaacggtacacgtccagctaagacagcaacatggcctaagtacaactac
taccgtgcagatgagaaatatcaagatatcgctcgtatgcttggccttccagcttctact
ccagaagaaggtgtggaatcttacgcaaaagctgtctacgaacttggtgagcgcgtaggt
atccaaatgaacttcaaagcacaaggaatcgatgaaaaagaatggaaagaacattcacgt
gaattggccttccttgcttacgaagatcaatgttcaccagctaacccacgccttccaatg
gttgaccatatgcaagaaatcatcgaagattcttactatggttacaaagaaagaccagga
cgccgtaaataa

DBGET integrated database retrieval system