KEGG   Streptococcus mitis: smi_0544Help
Entry
smi_0544          CDS       T01173                                 

Definition
Indole-3-glycerol phosphate synthase (IGPS) (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smb  Streptococcus mitis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    smi_0544
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    smi_0544
Enzymes [BR:smb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     smi_0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
491251..492018
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKAREVEQMELEEIQPLRQTYCLADYLKQHQDRLQVIAEVKKASPSLGD
INLDVDIVQQAQTYEENGAVMISVLTDEVFFKGHLDYLREISSQVQIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALSEERLKELYDYATELGLEVLVETHNLAELEVAHRLGAQIIG
VNNRNLTTFEVDLQTSVDLAKHFKDDCLYISESAIFTGQDAERVAPYFNGILVGTALMQA
EDVAQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttggagcagaaggcgcgtgaggtcgagcagatg
gagctggaggaaatccagcctctgcgccagacctattgcttggctgactatctaaaacaa
caccaagaccgtttacaggtaatcgctgaggtcaagaaggctagccctagtctgggagat
atcaatctagatgtggatattgtgcaacaggcccagacttatgaagaaaacggagcagtg
atgatttctgttctgacagatgaagttttctttaaaggacatttggattatctacgagag
atttccagtcaggtacagattccgacgctcaacaaggactttattattgatgaaaagcaa
atcattcgcgctcgcaatgcaggtgcgacagtcatcctgctcattgtggcagccttgtca
gaagaacgtcttaaggaactttatgactatgcgacagagcttggtctggaagtcttagtg
gagactcacaatctagctgaactagaggtagctcaccgccttggggctcaaattatcggg
gtcaataatcgcaacttgaccacctttgaagttgacttgcagaccagtgtagatttggct
aaacatttcaaagatgattgcttgtacatttctgaatctgctatttttacaggacaggat
gcggaacgagtagcgccatactttaacggaattttagtagggacagctctcatgcaggca
gaagatgtagcccaaagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system