KEGG   Streptococcus mitis: smi_0546Help
Entry
smi_0546          CDS       T01173                                 

Definition
(RefSeq) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smb  Streptococcus mitis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    smi_0546
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    smi_0546
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    smi_0546
Enzymes [BR:smb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     smi_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492582..493805
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQEDPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDLTGQDLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPDKAMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaagaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctatcgtgaaagtcaggaa
gatccaagtttccaagaggaattaaaccaactcttgcgtcagtacgtgggacgcgaaact
cccctttattacgcaaaaaatttgactcagcatatcggaggagccaagatttatcttaaa
cgtgaagacctcaaccatacaggggcccacaagattaacaatgccttgggacaagttctt
ctggctaaacgcatgggtaaaaagaaaattatcgcagaaacaggtgctggtcagcacggt
gtagcaactgcaactgctgcagccctctttaacatggaatgtactatctacatgggtgag
gaagatgtcaaacgccaagcccttaatgtcttccgtatggagcttttgggagccaaggtc
gaggctgtgactgatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtggctaatatcgatgatacccactatatccttggctctgccttaggacctcatcca
ttcccagaaatcgttcgtgacttccaaagtgtcatcggtcgagaagctaaacaacagtac
cgtgacttaacaggtcaagatttaccagatgccctagtagcttgtgttggtggtggttct
aacgctatcggtctcttccatccatttgtagaagatgagtcagtagctatgtatggagct
gaagcggctggacttggtgtggatacagagcaccacgcagctaccttgaccaaggggcgt
ccaggtgttcttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagaacattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaaggaattatcccagccttggaatctagccatgctatc
gcttttgcagtgaaattggccaaagaacttggaccagacaaagccatgatagtatgtcta
tcaggtcgtggggacaaggatgtggttcaagtcaaagaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system