KEGG   Streptococcus mitis: smi_0547Help
Entry
smi_0547          CDS       T01173                                 

Definition
(RefSeq) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smb  Streptococcus mitis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    smi_0547
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    smi_0547
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    smi_0547
Enzymes [BR:smb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     smi_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
493798..494574
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLAGLGETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQTLVETLKTIETEVPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLVDTDMALIPLVSLTTGIERQKELIEGAEGFVYAVAIN
GVTGKSGNYRADLDKHLVQLHQVADIPVLTGFGVSSQADVERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIKQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattgaatgctatcaaagcagctggaaaaggaattttt
gttccctatatcatggctggagaccatgagaaaggtttggctggactcggagaaacaata
cactttttagaagatttgggtgtttcggctattgaagtgggtattcccttttcagatcct
gtcgcagatggacctgttatagaagaagctggcctgcgcagtttagcccatgggacttct
acccagactttggttgaaaccttgaaaaccattgaaacagaggttccgctggtcatcatg
acctacttcaaccccctctttcagtacggcgttgagaactttgtcaaagatttagcagat
acagcggttaagggcttgattattccagaccttcctcatgagcatgccaattttgtagag
ccatttttggtagacacagacatggccttgattcctctagtaagcttgacaacagggatt
gagcgccagaaagagttgattgaaggggcagaaggatttgtctatgcggttgccatcaat
ggggtgacagggaaatctggcaattaccgtgcagacttggacaagcacttggtgcaactt
catcaagtggccgacattccagtcttgacaggatttggcgtatctagtcaagctgatgta
gaacgcttcaatgcggtgtcagatggtgttatcgttggttcgaaaattgtaaaagctctc
catcaaggagagccaattcaggactttatcaaacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system