KEGG   Streptococcus mitis: smi_0547Help
Entry
smi_0547          CDS       T01173                                 

Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smb  Streptococcus mitis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    smi_0547
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    smi_0547
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    smi_0547
Enzymes [BR:smb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     smi_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493798..494574
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLAGLGETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQTLVETLKTIETEVPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLVDTDMALIPLVSLTTGIERQKELIEGAEGFVYAVAIN
GVTGKSGNYRADLDKHLVQLHQVADIPVLTGFGVSSQADVERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIKQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattgaatgctatcaaagcagctggaaaaggaattttt
gttccctatatcatggctggagaccatgagaaaggtttggctggactcggagaaacaata
cactttttagaagatttgggtgtttcggctattgaagtgggtattcccttttcagatcct
gtcgcagatggacctgttatagaagaagctggcctgcgcagtttagcccatgggacttct
acccagactttggttgaaaccttgaaaaccattgaaacagaggttccgctggtcatcatg
acctacttcaaccccctctttcagtacggcgttgagaactttgtcaaagatttagcagat
acagcggttaagggcttgattattccagaccttcctcatgagcatgccaattttgtagag
ccatttttggtagacacagacatggccttgattcctctagtaagcttgacaacagggatt
gagcgccagaaagagttgattgaaggggcagaaggatttgtctatgcggttgccatcaat
ggggtgacagggaaatctggcaattaccgtgcagacttggacaagcacttggtgcaactt
catcaagtggccgacattccagtcttgacaggatttggcgtatctagtcaagctgatgta
gaacgcttcaatgcggtgtcagatggtgttatcgttggttcgaaaattgtaaaagctctc
catcaaggagagccaattcaggactttatcaaacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system