KEGG   Streptococcus mitis B6: smi_0678Help
Entry
smi_0678          CDS       T01173                                 

Definition
hypothetical protein
Organism
smb  Streptococcus mitis B6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
625533..625994
Genome map
AA seq 153 aa AA seqDB search
MKQTKTTKIALVSLLTALSVVLGYFLKIPTPTGILTLLDAGVFFAAFYFGSREGAVVGGL
AGFLIDLLSGYPQWMLFSLVNHGLQGFFAGFKGKTQWLGLILATIAMVGGYALGSTLMNG
WAAALPEILPNFMQNMVGMIVGFILSQSIKKIK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaccaaaacaactaaaatcgcccttgtatccctattaaccgccctctctgtg
gttctaggttatttcttaaaaattccaacaccgacaggcattctaactcttttagatgcg
ggtgtcttcttcgcggccttctactttggtagtcgtgaaggggctgtagtcggaggacta
gcaggtttcttgattgacctcttatcaggctatcctcagtggatgttatttagcttggtc
aaccatggcttgcagggatttttcgcaggatttaaaggaaaaactcagtggttaggcctt
atcttagcaacgattgccatggtagggggttacgccttgggttctacattgatgaatggc
tgggctgcagccctaccagaaatcctaccgaatttcatgcaaaatatggtagggatgatt
gtaggatttattcttagtcaaagtatcaagaagattaagtaa

DBGET integrated database retrieval system