KEGG   Streptococcus mitis: smi_0681Help
Entry
smi_0681          CDS       T01173                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase, Mur ligase (EC:6.3.2.-)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
smb  Streptococcus mitis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    smi_0681
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    smi_0681
Enzymes [BR:smb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     smi_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(628529..629872)
Genome map
AA seq 447 aa AA seqDB search
MKLKTTLGLLAGRSSHFVLSRLGRGSTLPGKLALQFDKDILQHLAKNYEIVVVTGTNGKT
LTTALTVGILKEVYGQVLTNPSGANMITGIATTFLTAKSSKTGKNIAVLEIDEASLSRIC
DYIQPSLFVITNIFRDQMDRYGEIYTTYKMILDAIRKVPTATVLLNGDSPLFYKPAIPNP
VQYFGFDLEKGPAQLAHYNTEGILCPDCQGILKYEHNTYANLGAYICEGCECKRPELDYR
LTELVELTNNRSRFVIDGQEYGIQIGGLYNIYNALAAVAIARFLGADSQLIKQGFDKSRA
VFGRQETFHIGNKECTLVLIKNPVGATQAIEMIKLAPYPFSLSVLLNANYADGIDTSWIW
DADFEQITDMDIPEINAGGVRHSEIARRLRVTGYPADKITETSNLEQVLKTIENQDCKHA
YILATYTAMLEFRELLASRQIVRKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaaactactttgggccttcttgctgggcgttcttcccacttcgttttaagc
cgtcttggccgtggaagtacgctcccaggaaaactcgcccttcaatttgataaagatatt
ttacaacacctagctaagaactacgagattgtcgtggtcactggaaccaacgggaaaacc
ttgacaactgccctcactgtcggcattttaaaagaggtttatggtcaagttctgaccaac
ccaagcggtgccaacatgattacagggatcgcaacgaccttcttaactgccaaatcgtct
aaaactggtaaaaatattgccgttctagaaatcgatgaagccagtctatctcgtatctgt
gactatatccagccaagcttatttgttatcaccaatatcttccgtgaccagatggaccgc
tatggtgagatttacacaacttacaagatgattttggatgctattcgtaaggtgcctact
gccactgttcttcttaatggagacagtccgcttttctacaagccagctatcccaaatccc
gtacagtattttggttttgacttggagaaaggccccgcccaactggctcactacaataca
gaagggattctctgtcctgactgtcaaggtatcctcaaatacgagcacaatacctatgca
aacttgggtgcctatatctgtgaaggttgcgaatgtaaacgtcctgaattagactatcgc
ttgacagaactggttgagttaaccaacaatcgctctcgctttgtcattgacggacaagaa
tacggtattcaaatcggtggtctctacaatatctacaacgccctagctgcggttgctatc
gcccgtttccttggtgcagattcgcaactcatcaagcagggatttgataagagccgtgct
gtctttggacgccaagaaaccttccatattggtaataaggaatgtaccctcgtcttgatt
aaaaatccagtcggtgcgacccaagctatcgagatgattaaactagcaccttatccattt
agtctatctgttcttcttaatgccaactatgctgatggaattgatactagctggatctgg
gatgctgattttgaacaaattactgacatggacattcctgaaatcaatgctggcggtgtt
cgccattctgaaatcgctcgtcgtctacgagtaactggctatccagctgataaaattact
gagacaagtaatctggaacaagttcttaaaaccattgaaaaccaagactgcaagcatgcc
tatatcttggctacctatactgctatgcttgaattccgcgaactgctggctagtcgtcag
attgttagaaaggagatgaactaa

DBGET integrated database retrieval system