KEGG   Streptococcus mitis: smi_0700Help
Entry
smi_0700          CDS       T01173                                 

Definition
(RefSeq) fructose-2,6-bisphosphatase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smb  Streptococcus mitis
Pathway
smb00010  Glycolysis / Gluconeogenesis
smb00260  Glycine, serine and threonine metabolism
smb00680  Methane metabolism
smb01100  Metabolic pathways
smb01110  Biosynthesis of secondary metabolites
smb01120  Microbial metabolism in diverse environments
smb01130  Biosynthesis of antibiotics
smb01200  Carbon metabolism
smb01230  Biosynthesis of amino acids
Module
smb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    smi_0700
  Energy metabolism
   00680 Methane metabolism
    smi_0700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    smi_0700
Enzymes [BR:smb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     smi_0700
Membrane trafficking [BR:smb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    smi_0700
Exosome [BR:smb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   smi_0700
  Exosomal proteins of melanoma cells
   smi_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 8797842
NCBI-ProteinID: YP_003445816
UniProt: D3H7V6
Position
648854..649399
Genome map
AA seq 181 aa AA seqDB search
MNNSYILLRHAHSKFSSDDFNRTLSEKGFSSLDQLEFLNSFNIDHYFSSPYKRAFETINS
SPIQFDKIVLDNRLRERKLSSTFIKDSEFEDSIKYLWQNPSESLSEGESNQGALARVLNF
LMELEERYSEKTILLSSHGNLIGILLHHFDSSFDYEKWEQMTFPDCFLIDRNGIVKRIMK
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcttatattttacttagacatgctcattcaaaattttcaagtgatgatttt
aatagaactttgtcagaaaaaggattttcatctcttgaccagttagagtttttgaattct
tttaatattgatcattatttttctagtccatataaacgagcatttgaaacgattaatagc
tcgccaattcaatttgataaaatagttcttgataatcggttacgagagcgaaaattatct
tcaacctttataaaagattctgagtttgaagacagtattaaatatttatggcaaaatccc
agtgaatctctttcagaaggggaatcaaatcaaggtgcactagctagagtactaaatttt
ttaatggaattggaagagagatactcagaaaaaacgattttacttagttcacacgggaat
ttgataggaatactactacatcactttgattccagttttgattatgaaaaatgggagcag
atgacctttccagattgttttctaattgatagaaatgggattgtgaaaagaattatgaaa
gattag

DBGET integrated database retrieval system