KEGG   Streptococcus mitis: smi_0700Help
Entry
smi_0700          CDS       T01173                                 

Definition
fructose-2,6-bisphosphatase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smb  Streptococcus mitis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    smi_0700
   01230 Biosynthesis of amino acids
    smi_0700
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    smi_0700
  Energy metabolism
   00680 Methane metabolism
    smi_0700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    smi_0700
Enzymes [BR:smb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     smi_0700
Exosome [BR:smb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   smi_0700
  Exosomal proteins of melanoma cells
   smi_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648854..649399
Genome map
AA seq 181 aa AA seqDB search
MNNSYILLRHAHSKFSSDDFNRTLSEKGFSSLDQLEFLNSFNIDHYFSSPYKRAFETINS
SPIQFDKIVLDNRLRERKLSSTFIKDSEFEDSIKYLWQNPSESLSEGESNQGALARVLNF
LMELEERYSEKTILLSSHGNLIGILLHHFDSSFDYEKWEQMTFPDCFLIDRNGIVKRIMK
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcttatattttacttagacatgctcattcaaaattttcaagtgatgatttt
aatagaactttgtcagaaaaaggattttcatctcttgaccagttagagtttttgaattct
tttaatattgatcattatttttctagtccatataaacgagcatttgaaacgattaatagc
tcgccaattcaatttgataaaatagttcttgataatcggttacgagagcgaaaattatct
tcaacctttataaaagattctgagtttgaagacagtattaaatatttatggcaaaatccc
agtgaatctctttcagaaggggaatcaaatcaaggtgcactagctagagtactaaatttt
ttaatggaattggaagagagatactcagaaaaaacgattttacttagttcacacgggaat
ttgataggaatactactacatcactttgattccagttttgattatgaaaaatgggagcag
atgacctttccagattgttttctaattgatagaaatgggattgtgaaaagaattatgaaa
gattag

DBGET integrated database retrieval system