KEGG   Streptococcus mitis: smi_0700Help
Entry
smi_0700          CDS       T01173                                 

Definition
fructose-2,6-bisphosphatase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smb  Streptococcus mitis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    smi_0700
   01230 Biosynthesis of amino acids
    smi_0700
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    smi_0700
  Energy metabolism
   00680 Methane metabolism
    smi_0700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    smi_0700
Enzymes [BR:smb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     smi_0700
Exosome [BR:smb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   smi_0700
  Exosomal proteins of melanoma cells
   smi_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648854..649399
Genome map
AA seq 181 aa AA seqDB search
MNNSYILLRHAHSKFSSDDFNRTLSEKGFSSLDQLEFLNSFNIDHYFSSPYKRAFETINS
SPIQFDKIVLDNRLRERKLSSTFIKDSEFEDSIKYLWQNPSESLSEGESNQGALARVLNF
LMELEERYSEKTILLSSHGNLIGILLHHFDSSFDYEKWEQMTFPDCFLIDRNGIVKRIMK
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcttatattttacttagacatgctcattcaaaattttcaagtgatgatttt
aatagaactttgtcagaaaaaggattttcatctcttgaccagttagagtttttgaattct
tttaatattgatcattatttttctagtccatataaacgagcatttgaaacgattaatagc
tcgccaattcaatttgataaaatagttcttgataatcggttacgagagcgaaaattatct
tcaacctttataaaagattctgagtttgaagacagtattaaatatttatggcaaaatccc
agtgaatctctttcagaaggggaatcaaatcaaggtgcactagctagagtactaaatttt
ttaatggaattggaagagagatactcagaaaaaacgattttacttagttcacacgggaat
ttgataggaatactactacatcactttgattccagttttgattatgaaaaatgggagcag
atgacctttccagattgttttctaattgatagaaatgggattgtgaaaagaattatgaaa
gattag

DBGET integrated database retrieval system