KEGG   Streptococcus mitis: smi_1166Help
Entry
smi_1166          CDS       T01173                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smb  Streptococcus mitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    smi_1166 (glgB)
Enzymes [BR:smb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     smi_1166 (glgB)
Exosome [BR:smb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   smi_1166 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1155597..1157525)
Genome map
AA seq 642 aa AA seqDB search
MDKKKALETFMTGENFHLQHYLGAHKEEKNGEYGYTFRVWAPNAQAVHLVGDLTNWVENQ
IPMERNEFGVWEVFTSLAQEGQIYKYHITRANGHQLMKIDPLAVRYEARPGTGAILTEIP
EKKWKDGLWLARRKRLSFEERPVNIYEAHAGSWKRNPDGSPYSFAQLKDDLIPYLVEMNY
THIEFMPLMSHPLGLSWGYQLMGYFALEHAYGRPEEFQDFVEECHLNNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHNKAHNYGWGALNFDLGKNEVQSFLISSIKFWIDFYHLDG
IRVDAVSNMLYLDYDDAPWTPNKDGGNLNYEGYYFLKRLNDVIKQAHPDVMMIAEESSSA
TQITDTKDSDGLGFDYKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYVFKENYLLPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNIYTYQICHPGKKLLFMGSEYGQFLEWKSEEQ
LEWSNIEDPMNAKMKYFTSQLNQFYKDHRCLWEIDTSYDGIEIIDADNRDQSVLSFIRKG
KKGDMLVCVFNMAPVERKDFTIGLPVAGIYEEVWNTELEEWGGVWKEHNQTVQTKEGLWK
DYEQTLTFTLPAMGASVWKIKRRLKSDKTVTSKNQKGVENEE
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggataagaaaaaagctttagaaacctttatgacaggtgaaaattttcacctccagcac
tatctgggagcacataaggaagaaaaaaatggagagtatggctatacttttcgtgtgtgg
gcacccaatgcacaggctgttcacttggtaggggatttaaccaattgggttgaaaatcaa
attccaatggaacgaaatgaatttggagtctgggaagtctttactagtcttgctcaagaa
ggccaaatttataagtatcatatcacacgtgcaaatggtcatcagctgatgaagattgat
cctttggctgtaaggtatgaggcacgacctgggactggagcgattttaacagagattcca
gagaaaaaatggaaggatggtctatggttagctcgtagaaaacgcttgagctttgaagag
cgtcctgtcaatatttacgaggctcatgctggttcttggaagagaaatccagacggtagt
ccctatagttttgctcaattgaaagatgatctcattccttacttggttgagatgaactat
actcacattgagtttatgcctttgatgtctcacccactcggtttgagttggggctatcag
cttatgggttactttgctctagagcatgcctatggtcgtcctgaagagtttcaagatttt
gttgaggaatgtcacttaaacaatataggtgttattgtagattgggtacctggtcacttc
accattaatgatgatgccttggcctattatgatgggacaccgacttttgagtatcaggac
cataataaggctcataactatggttggggagcactcaattttgaccttggaaagaatgaa
gtccagtccttcttgatttctagtattaagttttggattgacttttaccatctagatggt
attcgcgtggatgcagttagcaacatgctctatcttgactacgatgatgctccatggaca
cctaacaaggatggtggcaatctaaactacgaaggctattatttcttaaaacgtttgaat
gatgtcattaaacaagctcatccagatgtgatgatgatagctgaggaaagttcatcagct
actcagattactgacaccaaggattcagatggtcttggcttcgactacaaatggaatatg
ggctggatgaatgatatcctccgtttctatgaagaagatccgatttatcgtaaatatgac
tttaacctggtgactttcagctttatgtatgtcttcaaggagaactatctcctaccattc
tcgcacgatgaagtggttcatggcaagaagagtatgatgcacaagatgtggggagatcgt
tataatcaattcgcaggcttgcgcaatatctacacttaccaaatttgtcacccaggtaaa
aaattgctcttcatgggtagtgaatatgggcaattcctagaatggaaatctgaagaacag
ttggaatggtctaatatagaagatccaatgaatgctaagatgaagtatttcacttctcag
ctaaaccagttttacaaagaccaccgctgtctgtgggaaattgataccagctatgatggt
attgaaatcatcgatgcggataatcgagaccagagtgttctgtccttcatccgtaagggg
aaaaagggcgatatgttagtctgtgtctttaatatggcacctgttgaacgaaaagatttt
acaatcggccttcctgttgcagggatttatgaagaagtctggaatactgagttagaagag
tggggcggtgtctggaaagaacacaatcaaactgttcaaacgaaagaaggattatggaaa
gattatgagcagacattaacctttaccctaccggctatgggagctagtgtatggaaaatc
aagcgtcgcttgaaatctgataaaactgtcacaagtaaaaaccaaaaaggagtagaaaat
gaagaatga

DBGET integrated database retrieval system