KEGG   Streptococcus mitis: smi_1235Help
Entry
smi_1235          CDS       T01173                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
smb  Streptococcus mitis
Pathway
smb00240  Pyrimidine metabolism
smb00250  Alanine, aspartate and glutamate metabolism
smb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    smi_1235 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    smi_1235 (pyrB)
Enzymes [BR:smb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     smi_1235 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 8798782
NCBI-ProteinID: YP_003446345
UniProt: D3H9D5
Position
complement(1234607..1235530)
Genome map
AA seq 307 aa AA seqDB search
MSENQQALNHVVSMEDLTVDQVMKLIKRGIEFKNGAQLPYEDHPIVSNLFFEDSTRTHKS
FEVAEIKLGLERLDFDVKTSSVNKGETLYDTILTLSALGVDVCVIRHPEVDYYRELIASP
TITTSIINGGDGSGQHPSQSLLDLMTIYEEFGHFEGLKVAIAGDLDHSRVAKSNMQILKR
LGAELYFAGPEEWRSQEFADYGQFVTIDDIIDQVDVMMFLRVQHERHDSGAVFSKEDYHA
QHGLTQERYERLKETAILMHPAPVNRDVEIADHLVEAPKSRIVQQMTNGVFVRMAILESV
LASRNAN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatcaacaagcattgaaccatgtggtgtccatggaagacctcactgtcgat
caagtgatgaaattgatcaagcgaggaattgagtttaaaaatggagctcagcttccttat
gaagaccatccgattgtttccaatcttttctttgaggattctacacggacgcataagtcc
tttgaagtggcagagattaaactgggattggagcgacttgactttgatgtgaagactagc
tcagtcaataagggtgaaacactttatgatactattttaaccttatctgctttaggagtg
gatgtctgtgtgattcgccacccagaggttgactactacagagagttaattgctagtccg
acgattacgacttccatcatcaatggtggagatggttcgggacaacatcctagccagagc
ttgctggatttgatgactatttatgaggaatttggtcactttgagggtctcaaggttgcg
attgcaggtgacttggaccactcacgcgttgctaaatccaatatgcagattttgaaacgc
ttgggagctgaactttactttgctggacctgaggaatggagaagtcaagagtttgcagac
tatggacagtttgtaaccattgatgacatcattgatcaggtggatgtcatgatgtttctc
cgtgtgcaacatgaacgccatgatagtggtgcagttttttcaaaagaagactaccatgcc
caacatggcttgactcaagaacgttacgaacgcttaaaagaaacagcaatcctcatgcac
ccagctccagtcaatcgtgatgtagaaatcgcagatcacttggttgaagcaccaaaatca
cggattgtccaacaaatgaccaatggtgtttttgttcgaatggcaatcttagaatccgta
ctggcgagtagaaacgccaactaa

DBGET integrated database retrieval system