KEGG   Streptococcus mitis: smi_1247Help
Entry
smi_1247          CDS       T01173                                 

Definition
type III restriction endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
smb  Streptococcus mitis
Brite
Enzymes [BR:smb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     smi_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1245734..1248811)
Genome map
AA seq 1025 aa AA seqDB search
MRLQFKKQQFQLDAVSAIADLFQGQAKHTGVQYMADPGRLKSDEVDLVLDAYRNAPIQLS
QASIRENVHAVQTRFGLRPSESLSIDRVNGNPAYNFSIEMETGTGKTYTYIRTIMELNKR
YGWLKFVIVVPSVAIREGVLKSLQIMSSHFQVEYGKQPRYFVYDSSRLGDLDSFANSSDL
QIMVINIQAFNAKGKDARRIHSEQESFRWRRPIDVLAAMNPIMIIDEPQSANGKQTKMGL
KDFKPLFTLRYSATHKEKHDMVYRLDAMDAYNQKLVKKIAVKAIEQTGTTGTQGYLYLQE
IIPQKTGAPKAKIEFEVKMQSGVKRKLKVVEEPFDLYAESGNLSAYKGMTLSHFDARENK
LQVGVTQELHVGEVIGEVDESSIRRIQIRETIKSHIEKESKLYNRRIKVLSLFFIDEVAK
YKQYDEHNDAYNGEYAQIFEEEYRNQVNQFIQTQEPTPYRRYLEANLEGNSVHAGYFSVD
KVKKSDKTIFVDYKSTSEKKSNLSNDTDAYDLIMKDKERLLSFEEPVRFLFSHSALREGW
DNPNVFQICTLKKSSAEVGKRQEIGRGMRLAVDQNGIRQDFELLGNDVHEINKLTVIANE
SYDQFARNLQEEIKELLADRPAKVDVTLFTNKVLTNQEGQTIRITKEQADSIHFDLIRQG
YIDREGQLTTEYFTAKENHQLQLSETLAGYEDKLVEILESVYHAGQYEIENANNAVIQFS
NEVNQENIARKEFLNLWKQINRKTSYQVEFDDAELVKHSVDYINEKLVVSKPSFHITQAS
ATEMSKEEGLHLTVAENDRQQEYLTDSQIMTKYDLLGEIADQTGLTRKLVAEILSKIYVY
QFDKFKQNPEEFILKVSKLINEQKASQIIKHIQYNVLSEEYDMDLFYDNPETANRSDDYL
LESKKGIYNFVKVDSNTEKTFKESLEQYEDVRVYVKLPGKFSIATPLGNYNPDWAIAFRE
GSVKHIYFVAETKGSMSSLQLKQAEQAKIACARAHFKALAQAGLINDQHIYDVVSSYEEL
LNIVR
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgagattacaatttaaaaaacaacaattccagttggatgcggtgagtgctattgcagat
ttatttcaagggcaagccaaacatactggagttcagtatatggcggatccaggtcgtctc
aagtcagatgaggtagatttggttttagatgcttatcgaaatgcaccgattcaattgagt
caagcaagtatacgagaaaatgttcatgccgtacaaactcgttttggattaagaccttct
gaaagtctttctattgatagagttaatggcaacccagcttataatttttccatagagatg
gagacgggaacagggaagacctacacgtacatccgtaccattatggagttaaataaacga
tacggatggcttaagtttgttattgtcgttccaagtgtagccattcgtgaaggagttctc
aagtctctgcagatcatgtcaagtcactttcaggtggagtatggcaaacaaccacgctat
tttgtctacgattcttcacgtttaggtgatttggatagttttgccaattcgtcagacctt
caaatcatggtcattaacattcaagcctttaatgcaaaaggaaaagatgcgcgacgaatt
cattctgaacaggaaagtttccgttggcgccgtccaattgatgtactggcagctatgaat
ccgattatgattattgatgaacctcagtctgctaatggtaaacaaaccaagatgggacta
aaagatttcaagccattgtttacactacgttattcggctacccataaagaaaaacatgat
atggtttatagattggatgccatggatgcttacaatcaaaaattagtgaagaagattgcg
gttaaggctattgaacaaactggtacgactgggacacaaggctatctttatctacaagaa
atcattccacaaaaaacaggagcacccaaagcaaaaattgagtttgaagtaaaaatgcag
tcaggtgtcaaaaggaaattgaaagtggtggaagaaccctttgatttgtatgctgaatca
gggaatttatctgcttataaaggaatgacccttagtcactttgatgcaagagagaacaaa
cttcaagttggtgtgacgcaagaacttcatgtcggtgaagtgataggggaagtggatgag
tctagcatcagaagaattcaaatccgagagactataaaaagtcatatcgaaaaggaaagt
aaactttataatcgaagaattaaagtattatccttatttttcatcgatgaagtggccaag
tataaacaatatgatgaacataatgatgcctataatggtgaatatgctcagatttttgaa
gaggaataccgaaatcaagtaaaccagtttatccaaacacaggaaccaactccttatcgt
aggtatttggaggctaatcttgaaggaaattcagttcatgctggttacttttcggtagat
aaagtgaagaagtcagataagaccatttttgtggattataaatctaccagtgaaaagaaa
agtaatctttcaaatgacaccgatgcctatgacttgattatgaaggacaaggagcgtttg
ttgagctttgaagagccagttcgtttcctcttttctcactcagctctaagagagggatgg
gataatcctaatgtctttcaaatttgtactctcaaaaaatcttcagcagaggttggaaag
cgtcaagaaatcggtcgtggtatgcgtttggcagttgatcaaaatggaattcgtcaggat
tttgaactcctaggaaatgatgttcatgaaatcaataaactgacagtaattgcaaatgaa
agctatgatcaatttgctcgaaatctacaagaagaaatcaaagaacttttagcagatcgt
cctgcaaaagtggatgttactctctttacgaataaagttctaaccaatcaagaaggacaa
acaatacgtattaccaaggaacaagcagattcgattcattttgatttgatccgacaaggc
tatatagaccgtgaaggacaattgaccacagaatattttactgcaaaagaaaatcatcag
ttacaactgtctgaaacgctagcaggttatgaggataagctggtagagatattggagagt
gtttatcatgctggacagtatgaaattgaaaatgccaataatgcggtaatacaattctca
aatgaggtcaatcaagaaaatattgctcgaaaagaatttttaaatctctggaagcaaatc
aatcgtaagacgagttaccaagtagagtttgatgatgcggaattggtaaaacattcggtt
gactatatcaatgagaaattagtcgttagcaaaccaagctttcatataactcaagcaagc
gctactgagatgagtaaggaagaaggtctccatctgacagtggctgagaatgatcgccaa
caagaatatctaacggattcgcagattatgaccaaatatgatttgctaggggagattgct
gatcagactggtttaactcgtaagttggttgcggaaatattaagtaaaatctatgtctac
caatttgacaagtttaaacaaaatccagaagagtttattcttaaggtttcaaaactaatt
aatgaacaaaaagcaagtcaaattatcaagcatattcagtataatgtattaagtgaagag
tatgatatggacttgttttatgacaatcctgaaactgctaacagatcagatgattactta
cttgaatccaaaaaaggaatttacaattttgtaaaagttgattcaaatacggagaagacc
tttaaagaatctttggaacaatacgaggatgttcgtgtttatgtgaagctaccagggaag
ttcagtattgctactccgcttgggaactataaccctgactgggcaattgccttccgtgaa
ggaagtgtcaagcatatctattttgttgcagaaacgaaaggctctatgtctagtcttcaa
ttaaagcaagctgagcaagcaaaaattgcctgtgcgcgtgctcactttaaagctttggca
caagctggattgattaatgatcagcacatctatgatgtggtttctagctatgaggaatta
ttaaatattgtaagatag

DBGET integrated database retrieval system