KEGG   Streptococcus mitis: smi_1564Help
Entry
smi_1564          CDS       T01173                                 

Definition
(RefSeq) triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smb  Streptococcus mitis
Pathway
smb00010  Glycolysis / Gluconeogenesis
smb00051  Fructose and mannose metabolism
smb00562  Inositol phosphate metabolism
smb01100  Metabolic pathways
smb01110  Biosynthesis of secondary metabolites
smb01120  Microbial metabolism in diverse environments
smb01130  Biosynthesis of antibiotics
smb01200  Carbon metabolism
smb01230  Biosynthesis of amino acids
Module
smb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    smi_1564
   00051 Fructose and mannose metabolism
    smi_1564
   00562 Inositol phosphate metabolism
    smi_1564
Enzymes [BR:smb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     smi_1564
Exosome [BR:smb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   smi_1564
  Exosomal proteins of bladder cancer cells
   smi_1564
  Exosomal proteins of melanoma cells
   smi_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 8799052
NCBI-ProteinID: YP_003446666
UniProt: D3HAA6
Position
complement(1607102..1607860)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAAAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETNEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
atcgcagctccagctcttgatttgacaactgttcttgctgctgctaaaggttcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgattacgttgttatcggtcactcagaacgtcgt
gactacttccatgaaactaacgaagatatcaataaaaaagcaaaagcaatctttgcaaac
ggtatgcttccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcatcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgacgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgacttcggt
caagaagttgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaacgtt
gcttcatacatggcttgtccagacgttgacggtgcccttgtgggtggtgcgtcacttgaa
gcagaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system