KEGG   Streptococcus mitis: smi_1564Help
Entry
smi_1564          CDS       T01173                                 

Definition
(RefSeq) triose phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smb  Streptococcus mitis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    smi_1564
   01230 Biosynthesis of amino acids
    smi_1564
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    smi_1564
   00051 Fructose and mannose metabolism
    smi_1564
   00562 Inositol phosphate metabolism
    smi_1564
Enzymes [BR:smb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     smi_1564
Exosome [BR:smb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   smi_1564
  Exosomal proteins of bladder cancer cells
   smi_1564
  Exosomal proteins of melanoma cells
   smi_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1607102..1607860)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAAAKGSNL
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETNEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
atcgcagctccagctcttgatttgacaactgttcttgctgctgctaaaggttcaaacctt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgattacgttgttatcggtcactcagaacgtcgt
gactacttccatgaaactaacgaagatatcaataaaaaagcaaaagcaatctttgcaaac
ggtatgcttccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcatcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgacgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgacttcggt
caagaagttgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaacgtt
gcttcatacatggcttgtccagacgttgacggtgcccttgtgggtggtgcgtcacttgaa
gcagaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system