KEGG   Streptococcus mitis: smi_1628Help
Entry
smi_1628          CDS       T01173                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
smb  Streptococcus mitis
Pathway
smb00230  Purine metabolism
smb01100  Metabolic pathways
Module
smb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    smi_1628
Enzymes [BR:smb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     smi_1628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 AAA_22 AAA RsgA_GTPase MEDS NB-ARC
Motif
Other DBs
NCBI-GeneID: 8799293
NCBI-ProteinID: YP_003446730
UniProt: D3HAH0
Position
complement(1679085..1679711)
Genome map
AA seq 208 aa AA seqDB search
MADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTRE
EFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVF
IFLTPPDLDELQDRLVGRGTDSAEVIAQRIEKAKEEIALMREYDYAIVNDQVPLAAERVK
RVIEAEHFRVDRVIGHYQEMLPKSPTTR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccgaggcttactaatcgttttttctggtccttcaggggttggaaaaggaacg
gttagaagagagatttttgagagttctgaaaaccaatttcaatactctgtatcgatgacg
acacgcgcacaacgtcctggagaagtggacggtgttgactatttcttccgtactcgtgaa
gagtttgaagagctgattcgtcaaggacagatgttggaatatgcagaatatgtcggcaac
tactatggaactcctctgacctacgtcaatgaaaccttggacaagggaatcgatgttttc
cttgaaattgaagttcaaggcgctcttcaggtcaagaaaaaggttccagatgctgtcttt
atcttcctgacaccaccagatttggatgaattgcaagatcgtttggtgggacgtggaaca
gacagtgcagaagtgattgcccaacgaatcgaaaaagccaaggaagaaattgccctcatg
cgtgagtatgattatgcgattgtcaacgatcaggtgcccctagctgctgagcgtgtcaaa
cgtgtgatcgaagcagagcacttccgtgtggatcgtgtcattggtcactatcaggagatg
ttaccaaaatctccaactactcgataa

DBGET integrated database retrieval system