KEGG   Streptococcus mitis: smi_1738Help
Entry
smi_1738          CDS       T01173                                 

Definition
ATP-dependent exoDNAse (exonuclease V), alpha subunit-helicase superfamily I member
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
smb  Streptococcus mitis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    smi_1738
Enzymes [BR:smb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     smi_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1791513..1793879
Genome map
AA seq 788 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAENFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYERAKPTSKGLVKYFSSSHFKGIGLKTAQKIVDTYGDNTIDEIL
QHPEKLEGIAGLSAKNRESFVSTLRLNYGTEMVLAKLANYGIPNKLAFQIQDFYKEETLD
VVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGLVHSLFQACMETGDTYVEA
RDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQIDTKIFDNSLFFAEEGIRSHL
VRILEKGKQKSHDLETIKKHIATVEEELGIEYDSIQKQAIYDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDLKKKSNLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDD
DTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLHIPLIPQTRLEKIYRQSEESTIVTLASQIRQGILPADFTQKKADRSYFEIASGHIPAT
IEKILGAALRSGIPARDIQVLAPMYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYR
KGDKVIHLVNDAEINVFNGDLGAITDLIPGKYTESKQDEIVIDFDGNEVSYPRNEWYKIR
LAYAMSIHKSQGSEFPVVILPITSASRRMLERNLIYTAITRAKSKLILLGELQSFNYATQ
HIGTARKTYLVERFSDLIENMEEKQPAVSETATSSTSEPSYILTEENWDSIPAMIGITDA
DLKEIFGK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggaaccattgaacggattatttttgaaaatcccagcaatttt
tatcgtattcttctcctagaaatcgacgatacagacgcagaaaactttgatgattttgaa
attattgtcactggcaccatggctgatgtgattgaaggagaagactatactttttgggga
caaattgtccagcactccaagtatggggaacaactgcaaatcagccgatatgaacgcgca
aaaccaactagcaagggcttggtcaagtacttttcaagtagccatttcaagggaattggt
ctcaagacagctcagaaaatcgtggacacctatggcgacaataccattgacgaaattttg
caacaccccgaaaagttagaaggcatcgcaggactctctgccaaaaatcgcgagtctttc
gtctccaccctccgtctcaactacggaacggagatggttttggccaaactagccaactac
ggcattcccaataaattagcctttcagattcaagacttttacaaggaagaaacccttgat
gtggttgaaaattatccctaccagctggttgaggacatcaagggtttgggctttaccatt
gccgaccaattagcggaagaactaggcatcgaaagtcaggcccctgaacgcttccgcgcc
ggtctagttcatagtctttttcaggcctgtatggaaacaggggacacctatgttgaagca
cgggatttgctagaacaaacccttactctccttgaatcttcccgccccgtagaactggat
cccagccaagtagctcaagagctctcctacctcatcgaagaagacaaggttcagcagatt
gataccaaaatctttgataatagcctctttttcgctgaggaaggcatccgcagtcacttg
gttcgtatccttgaaaaaggaaaacagaagagtcatgatttagaaaccattaaaaaacat
atcgctactgtcgaggaagaactggggattgagtatgatagcattcaaaaacaagctatc
tacgacgctattcagaacaaggtctttatcctgacaggtgggcctggtactggtaaaaca
actgttatcaatgggattatcgctgtatatgccctcttagaaggacttgacctcaagaaa
aaaagcaacctacccattctcctcgccgctccaactggtcgtgcagcgcgtcgtatgaat
gaactgacaggcttgccaagcgcgactatacaccgtcatttaggaatgacaggcgacgat
gatactagtcatctggaagattatctggatgctgactttatcatcgtagatgaattttcc
atggtggatacttggctggccaatcaactcttctccaacatctcttctaacagtaagatc
ctcatcgtgggcgacagcgaccagttgccttctgtcagtcctggacaggttctagcggat
ctgcttcatattcccttgattcctcagactcgcttggaaaaaatttaccggcaaagcgaa
gaatcaactatcgttaccctagctagtcagattcgacagggcatcttgcctgctgatttc
acccagaaaaaagcagaccgttcctactttgaaattgctagcggccatattccagctacg
attgaaaaaatcttaggcgctgccctaagaagtggtatccctgcccgtgatatccaagtt
ctggctcccatgtatcgaggaactgcagggattgacgctatcaatcagctcatgcaagac
ctgctcaacccaccacaaaaagatcaactcagttttgaagctccccagtgccattatcgt
aagggcgacaaggtcattcatttggtcaacgatgctgaaatcaatgtctttaatggagat
ttaggagccatcacagacctgattcctggtaaatacaccgagtcgaagcaagatgagatt
gtcattgattttgatggcaacgaggtctcttacccacgtaacgaatggtacaagattcgc
ctggcctatgccatgagcatccataaatcacagggaagtgagttccctgttgtcatccta
cctatcactagtgctagtaggcgtatgctggagcgaaacctcatctatacagcaattaca
cgcgccaaaagcaagcttatcttactaggtgaattacagtccttcaactatgctacccaa
catatcggaactgcccgaaaaacctatctggttgaacgcttcagtgatttaattgaaaat
atggaagaaaagcaaccagcggtctctgaaactgccacatcaagtacctctgaaccatcc
tacatcctaacagaagaaaactgggacagcatcccagccatgattgggattacagatgca
gacctcaaagagatttttggaaaatag

DBGET integrated database retrieval system