KEGG   Streptococcus mitis: smi_1774Help
Entry
smi_1774          CDS       T01173                                 

Gene name
gpo
Definition
gluthatione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
smb  Streptococcus mitis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    smi_1774 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    smi_1774 (gpo)
Enzymes [BR:smb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     smi_1774 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1833350..1833826
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQDNQETPLNAYRGKVLLVVNTATGCGLTPQYQGLQELYDRYQDQGFEIL
DFPCNQFMGQALGSAEEINTFCSLHYQTTFPRFAKIKVNGKEADPLYVWLKDQKSGPLGK
RIEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactatacgatttttcagtcttgaaccaagacaatcaagaaactccactaaat
gcctatcgtgggaaagttctcttggttgtcaacactgctactggatgtggtttaacgccc
cagtaccaagggctccaagaactctatgatcgctatcaagatcaaggttttgagatttta
gacttcccttgcaatcagtttatgggacaagcactgggcagcgcagaggaaatcaacacc
ttctgtagcctacattatcaaaccaccttcccacgttttgccaagatcaaggtcaacggt
aaggaagcagatcctctctatgtttggttgaaagaccagaaatctggcccactaggaaaa
cgaatcgaatggaatttcgctaagtttctcatcggtcgtgatgggcaggtctttgaacgc
ttctcttcaaaaacagacccaaaacaaattgaagaggccatacaaaaattactataa

DBGET integrated database retrieval system