KEGG   Streptococcus mitis B6: smi_1851Help
Entry
smi_1851          CDS       T01173                                 

Definition
glycosyl hydrolase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
smb  Streptococcus mitis B6
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smb00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1922471..1923850)
Genome map
AA seq 459 aa AA seqDB search
MLRFPKDFVWGSSTSGPQTEGRIAGDGKGDNLWDYWYQAEPNRYYNGIGLDKTSTFYENW
EQDIELLVETGHTAFRTSIQWSRIFPQGCGKVNPQGVDFYRKVFEAIKAKGIRLLVNLYH
FDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQWITFNEPIVPVEFGYFYDAH
YPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIGIVLNLTPAYPRSQHPADVKAAR
IADLFQAQSFLDPSVLGTYPQELVEILHEYGLLPDATEEELELIRENTVDFLGANYYQPL
RVMAPRFAKHPESPLLPEHFYEPYVMPGRKINPHRGWEIYEQGIYDIAQNIKENYGNIEW
ILTENGMGVEGEEKFRENGMIQDDYRIEFVKGHLRELHRAIEDGANCKGYLIWTFIDCWS
WLNSYKNRYGLVELDLKTQERRLKKSGHWFKELSDNNGF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatttccaaaggattttgtctggggatcctctacttctggaccgcagacagaa
ggacgtatagctggtgacggtaagggagataatctctgggattattggtaccaagcggag
ccaaatcgctactataatggaattggtctagataaaacatcgaccttttatgaaaactgg
gaacaggatattgagctactggtagaaactggtcacacggcctttcggacttctattcag
tggtcacggatttttccacaaggctgtgggaaagtcaatcctcaaggtgtagacttttac
cgtaaggtttttgaggctattaaggccaaagggattcgtcttttagtcaatctttaccat
tttgatctgccttttgctcttcaagaggatggtgatggttgggaaaataaggcgactgtc
tcagcctatgaagactatgctcgtttttgttttgagacttatggagatttagtggatcaa
tggattacctttaacgagcccatcgttccagtagaattcggctatttttacgatgcacat
tatccacataaggtggatgcagaagcggcggttaaagtagcctaccacacacaattggct
agcagtcgggcggttaaggcttgtcatgaactcttgcctgattccaagattgggattgtc
ctcaacttgacaccggcttatccacgtagccagcatcctgctgatgtcaaggcagctcgt
attgcggacctttttcaggcccaatctttcttagatccgtctgttttggggacttatcca
caggagttggtagaaatcttacatgaatacggtctcttgcctgatgctacagaggaggag
ttggagctcattcgtgaaaatacggtggacttcctcggtgccaactactatcaacctttg
cgtgttatggctcctcgatttgctaagcatccagagagtccactcttaccagaacatttt
tatgagccttatgtgatgcctggacgtaaaatcaatcctcaccgtggctgggagatttat
gagcaagggatttatgatatcgcccaaaatatcaaggaaaattatggcaatatcgagtgg
atattgactgagaatggaatgggtgttgaaggggaagaaaaattccgtgagaatggaatg
attcaagatgattaccgtattgaatttgtaaaaggtcatctgcgtgaacttcaccgtgcc
attgaagacggagccaattgtaagggctacttaatttggacctttatcgattgctggtca
tggctcaacagctataaaaatcgctatggtttggtcgaattagacttgaaaacgcaagaa
cgtcgtctgaagaaatcgggtcactggttcaaggaattaagcgataataatggattttaa

DBGET integrated database retrieval system