KEGG   Streptococcus mutans NN2025: SmuNN2025_0057Help
Entry
SmuNN2025_0057    CDS       T01185                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smc  Streptococcus mutans NN2025
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SmuNN2025_0057 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SmuNN2025_0057 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SmuNN2025_0057 (thrC)
Enzymes [BR:smc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SmuNN2025_0057 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67969..69453
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVSASQAILQGLARDGGLFTPTSYPQVDFDFDQLKTASYQEVAKLVL
SAFLDDFTEAELDYCIANAYDAKFDTPVIAPLVKLNGQYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGINNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPNGGVSKIQELQMT
TQVGDNTHVVAIEGNFDDAQTNVKKMFNDSDLRAKLLEHGAQFSSANSMNVGRLVPQVVY
YVYAYAQLLKSGDIKNGDRVNFTVPTGNFGNILAAYYARQIGVPIGKLICASNENNVLTD
FFKTGTYDKKREFRVTTSPSMDILVSSNLERLIFHLLGNDSVKTKELMQALIEKGEYTLE
KADKAILDLFAAGFATEEETAAEIKRVYTASRYIEDPHTAVASAVYHAYRKSSGDQSPTV
IASTASPYKFPRVVVSAVGGKDPKDDFAAVRELSRLSGVSVPRAVDGLETAEVRHRKVVA
TADMQKAVESYLGI
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtgtatcaatcaacccgtgatgaaaataataaggtaagcgccagtcaggct
attttgcaaggcttagcaagagatggcggtctttttacgccgacatcttatccacaagtt
gattttgattttgaccagcttaaaacggcttcctaccaagaagttgccaagttggtttta
tcagcttttttggatgattttacagaagcagaattggattattgtattgctaatgcctat
gatgctaagtttgatacaccggtcattgcgcctttagttaaacttaatggccaatataat
cttgaactttttcatggttcaactattgcctttaaggatatggcgctttcgattttgcct
tatcttttaacaacgtcagctaaaaagcaaggcattaataacaagatcgttattttaaca
gcgacatctggagatactggtaaggcagctatggcaggctttgcggatgttccggggaca
gaaattattgtcttttatcctaatggtggtgtcagtaagattcaagaattacaaatgacg
acacaggtaggagataatacacatgttgttgctattgaaggaaactttgatgatgctcag
acaaatgtcaaaaagatgttcaacgatagtgacctgcgagcaaaacttttagagcacggt
gcccaattttcatcggcaaactctatgaatgtcggacgtttagtgccacaagtggtttac
tacgtttatgcttatgcccagttgcttaagtcaggtgacattaaaaacggtgatagggtt
aactttacagtaccaacgggaaattttggaaatattttggctgcttattatgcacgtcaa
attggtgtgccaattggcaaacttatctgtgcttcaaatgaaaataatgttttgactgac
ttctttaaaacagggacttatgataagaaaagagaatttcgtgtaacaaccagtccctca
atggacattcttgtttcatctaatttggaacgccttatttttcatcttttgggaaatgat
tctgttaaaacaaaagaactcatgcaggctttgattgaaaagggtgagtatactttagaa
aaagctgataaagctattttagatttatttgctgcgggatttgcgactgaagaagagaca
gccgctgagattaaacgtgtttataccgcttcgcgttatattgaagatccgcatacagca
gttgcttcggctgtttaccatgcttataggaaatctagtggtgatcaaagcccaactgta
atagcttcaacagctagcccttataagtttccgcgtgtcgttgtttctgcagtcggaggt
aaagatccaaaagatgattttgcagctgtacgtgagctgagtcgtttatcaggtgtatca
gtgccaagggcagttgatggccttgaaactgctgaagttcgtcatcgaaaggttgtcgcg
acagctgatatgcaaaaagcagtagagtcatatttaggaatttaa

DBGET integrated database retrieval system