KEGG   Streptococcus mutans NN2025: SmuNN2025_0057Help
Entry
SmuNN2025_0057    CDS       T01185                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smc  Streptococcus mutans NN2025
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:smc00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:smc00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67969..69453
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVSASQAILQGLARDGGLFTPTSYPQVDFDFDQLKTASYQEVAKLVL
SAFLDDFTEAELDYCIANAYDAKFDTPVIAPLVKLNGQYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGINNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPNGGVSKIQELQMT
TQVGDNTHVVAIEGNFDDAQTNVKKMFNDSDLRAKLLEHGAQFSSANSMNVGRLVPQVVY
YVYAYAQLLKSGDIKNGDRVNFTVPTGNFGNILAAYYARQIGVPIGKLICASNENNVLTD
FFKTGTYDKKREFRVTTSPSMDILVSSNLERLIFHLLGNDSVKTKELMQALIEKGEYTLE
KADKAILDLFAAGFATEEETAAEIKRVYTASRYIEDPHTAVASAVYHAYRKSSGDQSPTV
IASTASPYKFPRVVVSAVGGKDPKDDFAAVRELSRLSGVSVPRAVDGLETAEVRHRKVVA
TADMQKAVESYLGI
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtgtatcaatcaacccgtgatgaaaataataaggtaagcgccagtcaggct
attttgcaaggcttagcaagagatggcggtctttttacgccgacatcttatccacaagtt
gattttgattttgaccagcttaaaacggcttcctaccaagaagttgccaagttggtttta
tcagcttttttggatgattttacagaagcagaattggattattgtattgctaatgcctat
gatgctaagtttgatacaccggtcattgcgcctttagttaaacttaatggccaatataat
cttgaactttttcatggttcaactattgcctttaaggatatggcgctttcgattttgcct
tatcttttaacaacgtcagctaaaaagcaaggcattaataacaagatcgttattttaaca
gcgacatctggagatactggtaaggcagctatggcaggctttgcggatgttccggggaca
gaaattattgtcttttatcctaatggtggtgtcagtaagattcaagaattacaaatgacg
acacaggtaggagataatacacatgttgttgctattgaaggaaactttgatgatgctcag
acaaatgtcaaaaagatgttcaacgatagtgacctgcgagcaaaacttttagagcacggt
gcccaattttcatcggcaaactctatgaatgtcggacgtttagtgccacaagtggtttac
tacgtttatgcttatgcccagttgcttaagtcaggtgacattaaaaacggtgatagggtt
aactttacagtaccaacgggaaattttggaaatattttggctgcttattatgcacgtcaa
attggtgtgccaattggcaaacttatctgtgcttcaaatgaaaataatgttttgactgac
ttctttaaaacagggacttatgataagaaaagagaatttcgtgtaacaaccagtccctca
atggacattcttgtttcatctaatttggaacgccttatttttcatcttttgggaaatgat
tctgttaaaacaaaagaactcatgcaggctttgattgaaaagggtgagtatactttagaa
aaagctgataaagctattttagatttatttgctgcgggatttgcgactgaagaagagaca
gccgctgagattaaacgtgtttataccgcttcgcgttatattgaagatccgcatacagca
gttgcttcggctgtttaccatgcttataggaaatctagtggtgatcaaagcccaactgta
atagcttcaacagctagcccttataagtttccgcgtgtcgttgtttctgcagtcggaggt
aaagatccaaaagatgattttgcagctgtacgtgagctgagtcgtttatcaggtgtatca
gtgccaagggcagttgatggccttgaaactgctgaagttcgtcatcgaaaggttgtcgcg
acagctgatatgcaaaaagcagtagagtcatatttaggaatttaa

DBGET integrated database retrieval system