KEGG   Streptococcus mutans NN2025: SmuNN2025_0117Help
Entry
SmuNN2025_0117    CDS       T01185                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smc  Streptococcus mutans NN2025
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:smc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:smc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138104..139471
Genome map
AA seq 455 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDEVKEGEILLEIMSDKTNMEIEAEDSGVLLKIV
KGNGQVVPVTEVIGYIGQAGEVLEIADVPASTVPKENSAAPAEKTKVMSSPTVAAAPQGK
VRATPAARKAARDLGVNLNQVSGTGAKGRVHKEDVESFKAAQPKATPLARKIAIDKGIDL
ASVSGTGFGGKIIKEDILNLFEAAQPVKDVSDPAKEAAALPEGVEVIKMSAMRKAVAKSM
VNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMEKTGFKVSFTDLIGLAVVKTLMKPEHR
YLNASLINDATEIELHQFVNLGIAVGLDEGLLVPVVHGADKMSLSDFVIASKDVIKKAQT
GKLKATEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIQTPTVVDGEIKIRPIM
ALCLTIDHRLVDGMNGAKFMVDLKKLMENPFTLLI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaaattattatgcctaaacttggtgttgatatgcaggaaggcgaaatcatc
gagtggaaaaaacaagaaggtgatgaggtcaaagaaggggagatcctccttgagattatg
tctgacaagaccaatatggaaatcgaagctgaggattcaggtgtcctgcttaagattgtt
aaaggaaatggtcaagttgttcctgtaactgaggtcattggttatattggtcaagcaggt
gaagttcttgaaatagctgatgttcctgcaagtacagttcctaaagaaaatagtgcagca
cctgctgaaaaaacaaaagtaatgtcttctccgacagttgcagcagcccctcaaggaaag
gttcgagcaacaccagcagctcgtaaggcggctcgtgatctaggagttaacctgaatcag
gtttcagggacaggcgctaaaggccgtgttcacaaggaagatgttgaaagctttaaagca
gctcagcctaaagcaacaccattagctaggaaaattgctatagataaaggtattgatcta
gccagtgtctcaggaacaggttttggcggcaaaattatcaaggaagatattttaaatctg
tttgaggcagctcagcctgttaaagatgtgtcagatcctgctaaagaagcagctgcctta
ccagagggtgttgaagtcattaagatgtctgccatgcgtaaggcagtggctaaaagcatg
gtcaattcttacctgacagctccaacttttactctcaattatgacattgacatgactgag
atgattgcgttgcgtaaaaagttaattgatcctatcatggaaaaaacaggttttaaagtt
agcttcacagatttgattggtctggcggtcgtaaaaaccttaatgaaaccagaacatcgt
tacctcaatgcttcgctcattaatgacgcgactgagattgaacttcatcaatttgttaac
cttggtatcgccgttggacttgatgaaggactgttagtacctgttgttcatggtgcagat
aagatgagcttgtcagattttgttatagcttcaaaggatgtcattaagaaagctcagacc
ggtaaattaaaagccactgaaatgtctggttcaaccttttccattacaaacttggggatg
tttggcactaagactttcaaccccattatcaatcagccaaattcggctattttgggtgta
ggagcaactatccaaacgccaactgttgtggatggtgaaattaagattcgtccaatcatg
gcactgtgcttgaccatcgatcaccgcttggttgatggcatgaacggcgctaagttcatg
gttgatcttaaaaaactgatggaaaatccatttacattattgatttga

DBGET integrated database retrieval system