KEGG   Streptococcus mutans NN2025: SmuNN2025_0162Help
Entry
SmuNN2025_0162    CDS       T01185                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
smc  Streptococcus mutans NN2025
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SmuNN2025_0162 (ipk)
Enzymes [BR:smc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SmuNN2025_0162 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188013..188861
Genome map
AA seq 282 aa AA seqDB search
MEIIEKAPAKINLGLDIAGKYQDGFHELSMIMASVDLNDYLTITEIAEDKIVVESNNCKL
PLNRKNDVYKAAHLLKRRYHISTGLKISLQKKIPICAGLGGGSSDAAATLRALNCLWKLN
LSPKELIDVGFEIGSDVPYCIEAGCALISGKGEIVEPLATTLSTWVVLVKPDFGISTKTI
FKEIDMATISRVDIPALKEALLANSYEDALQFMGNSLEDITIAKKPFIQKIKGRMIKCGA
DIALMTGSGPTVFALCRTEKRADHVVNSMKGFCKEVYKVRML
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaaattattgaaaaagctccggctaaaatcaatcttggtcttgatattgctggaaaa
tatcaagatggttttcacgaattgtcaatgattatggccagtgttgatttaaatgattat
ttgactattacagaaattgctgaggataagatagttgtagaatcaaataattgcaaatta
cctttaaaccgaaaaaatgatgtttataaagctgctcatcttctaaagaggagataccat
atctcaacggggctcaaaatatctcttcaaaaaaagatacctatatgtgctggtttaggc
ggcgggtccagtgatgctgctgcaactttacgtgctctcaattgtttgtggaaactcaat
ttatcaccaaaagaactaattgatgttggttttgaaattggaagtgatgttccttattgc
attgaagcaggctgtgctttaatttcaggtaaaggtgaaattgtagaacctttagcgact
actttgtcaacttgggtggttttggtcaaacctgattttggaatttcaacgaaaacaatc
tttaaagaaattgatatggcaacaatttctcgagttgatattcctgctctaaaagaggca
cttttagcaaattcttatgaagatgccttacaatttatggggaattctcttgaagatatt
actattgctaaaaaaccttttattcaaaaaataaaaggccgtatgataaaatgtggtgcg
gatattgctttgatgacgggaagtggaccaaccgtttttgctctctgtcgaacggaaaaa
cgagcggatcatgttgttaatagcatgaaaggcttttgtaaggaagtttataaagttaga
atgttatag

DBGET integrated database retrieval system