KEGG   Streptococcus mutans NN2025: SmuNN2025_0212Help
Entry
SmuNN2025_0212    CDS       T01185                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smc  Streptococcus mutans NN2025
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SmuNN2025_0212
  Amino acid metabolism
   00300 Lysine biosynthesis
    SmuNN2025_0212
Enzymes [BR:smc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SmuNN2025_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240181..241554
Genome map
AA seq 457 aa AA seqDB search
MAFSSEQEQIAKFWQDEVVQHYFEVLRTLISKKSIFAQQIGLQDVAGYLGEIFANVGAEV
TIDETYTAPFVIAKFKSSKPQAKTIIFYNHYDTVPADNDQIWTDNPFKLTLRKGYMYGRG
VDDDKGHITARLTAVRKYIREVGDLPVNVTFIIEGAEESASTDLDKYLKKYADSLLPADV
LIWEQGVKNSQGQLEITGGNKGIITFNLSVSSAEVDIHSKYGAVIESAAWYLLNAISSMR
ADDGQILIDGIYDQVLEPNERELDLVERYALENSEGLRKVYGLKLPTLKKERRDFLKTYF
FEPALSIEGLSSGYQGQGVKTILPSAASAKMEMRLVPGLSPQYVFEKINSHLRKLGFEHV
KVTYTLGEESYRSDMSAPAILTIIDLAKQFYEAGVSVLPTAAGTGPMHTVYDALGIPMLA
FGLGNPNSRDHGGNENVNLADYYTHIELIKELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcaagtgaacaagagcaaattgctaaattttggcaggatgaagttgttcag
cattattttgaggttttacggaccttaatttccaaaaaatctatttttgcacaacagata
ggcctgcaggatgttgcaggctatttaggcgaaatttttgccaatgtcggtgctgaagtg
acaattgatgaaacctatacggctccttttgttattgctaaatttaaaagttccaaacct
caggctaaaaccattattttttataaccattatgatacagtacctgcagataatgatcag
atttggacagataatccctttaaactgaccttaagaaagggttatatgtatggccgtggt
gttgatgatgacaaagggcatattacagctcgtttgacagctgttcgaaagtatattcgt
gaggttggggaccttcctgttaatgttacttttataatagaaggagctgaagaatctgct
tcaacagatcttgacaagtatttaaaaaaatatgcggatagtttgcttcctgcagatgtt
ttgatttgggaacaaggtgttaaaaatagtcagggtcagttagaaattacaggtggtaat
aaaggtattattacttttaatctttctgtatccagtgcagaggttgatattcactcaaaa
tatggtgcggttattgaatcggcagcatggtatctcttaaatgcaatttccagtatgcga
gcagatgatggtcagattttaatcgatggtatttatgatcaggtcttggagcccaatgag
cgtgaattggatttagtagagcgttatgctcttgaaaatagtgaaggtttgcgcaaagtt
tatggtttaaaattaccaactttaaaaaaagagcgtcgtgattttcttaaaacctatttt
tttgaacccgccttatccatagaaggactttcttctggttatcaagggcaaggtgtgaaa
acaattctgccttctgctgccagtgctaagatggaaatgcgtttagttcccggtctcagt
ccccagtacgtttttgaaaagattaatagtcatttgagaaaattaggctttgaacatgtt
aaggtaacctataccttaggcgaagaatcttatcgcagtgatatgagtgctccggctatt
ttgaccattattgacttggctaagcaattttatgaagctggcgtatctgttctgcccact
gctgctggtacaggtcctatgcatacggtttatgatgctttgggcattcctatgttagct
tttggacttggcaatcccaatagtcgcgatcacggtggtaatgaaaatgttaatttagca
gactattatacccatattgaattaattaaggagttaattagaagttatgagtaa

DBGET integrated database retrieval system