KEGG   Streptococcus mutans NN2025: SmuNN2025_0267Help
Entry
SmuNN2025_0267    CDS       T01185                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
smc  Streptococcus mutans NN2025
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(290116..292479)
Genome map
AA seq 787 aa AA seqDB search
MTYYFSGTIDRVIFENTSNFFKIILLEIDDTDSDFDDFEIIVTGTIADVIEGENYTFWGE
LTQHPKYGQQLKVERYQRAKPSSAGLIKYFSSQHFKGIGKKTAEKIIHLYGDDPIDNILE
DPDKLESISGLSKANRENLVSKLRLNYGAEQILAKLAEYGLNNKTAVQIFERYKEESLTV
ITENPYQLVEDIQGIGFKMADKLAEQVGINSDAPQRFRAALVHTLLETSIDKGDTYIEAK
ELLEKSLFILEEVRQVELDPSQIAQELTQLISEDKVQNIGTKIFDNTLFYAESGIHKHLT
RILDRPLEKEISSQDIQTEIKHIQAEFNINYDKAQKNAIQKAIQSKVFLLTGGPGTGKTT
VINGIIKVYANLHQIDLQKSDLPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDSEY
QALDVFLDCDLIIIDEFSMVDTWLANQLFSAIASNTQIVIVGDSDQLPSVGPGQVLADLL
KINRLPQVSLTKIFRQSEDSTIVTLANQIRQGRLPTDFTAKKADRSYFEAQSTHIPQMIQ
KIVSSALKSGIDAQEIQILAPMYRGQAGITHLNKLMQDLLNPLNNQLEFQFNDLHFRKGD
KVLHLINDAQINVFNGDIGYITDLIPAKYTESKQDEMILDFDGTEINYPRNEWLKITLAY
AMSIHKSQGSEFKVVILPVTRQSGRLLQRNLIYTAITRSKSKLVMLGEIAAFDNAIKNEG
TKRKTYLIERFKKDECSGHHNTEKNKQGVKESAAILKEDFILTERNILTIDPMIGLSQAD
IDLFFKK
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgacctattacttttcaggcaccattgaccgtgttatttttgaaaataccagcaatttt
tttaaaattattcttctggaaattgacgatactgacagcgattttgatgattttgaaatt
attgtgacaggtactattgctgatgttattgaaggagaaaactatactttttggggtgaa
ttgacccagcatcctaaatatggacagcagttaaaagtggaaagataccagcgtgctaaa
ccctcttctgctggtctgattaagtatttttccagtcagcatttcaagggaatcgggaaa
aaaacagccgaaaaaattattcacttatatggtgatgaccctattgataatattctggaa
gatcctgataagttagaaagcattagtggactttctaaggctaatagagaaaatttagtt
agtaaacttcgtcttaactacggtgctgaacagattctggcaaaattagcagaatatgga
ttaaataacaaaacagctgttcaaatttttgaacgctataaagaagaaagtttgactgtt
attactgaaaatccttatcaactggttgaggacattcaaggcattggattcaaaatggct
gacaaattagcagaacaagtaggtattaacagcgatgctcctcagcgttttcgtgctgct
cttgttcatactcttttagaaacctctattgacaaaggtgacacctatattgaagccaaa
gaattactcgaaaaatctctttttattcttgaagaggtgagacaagtcgaactggatccc
agtcaaattgctcaggaactgacacaattaatctccgaagataaggtacaaaatattggt
actaaaatctttgataatacgcttttttatgccgaatcaggcattcataagcatcttacc
cgcattctggatagaccacttgaaaaagagatcagtagccaagacattcaaactgaaatt
aaacatattcaagcagaatttaatattaactatgacaaggcacaaaaaaatgccatccaa
aaagccatccaaagcaaggttttccttttaacaggcggtccaggaaccggaaaaacgact
gtcatcaatggaattattaaggtttatgctaatttgcatcaaattgacctgcaaaaaagt
gacctacctattattctggctgccccgactggtcgtgctgctagacggatgaatgagcta
acaggtttacctagtgccaccattcaccggcatttaggacttaatggtgatagtgaatat
caggcacttgatgtttttctggattgtgatctcattattattgacgagttttctatggtt
gatacttggctagccaatcaattgtttagtgctattgcttcaaatacacaaattgttatt
gttggtgatagcgatcagctcccatccgtcggtccaggtcaagttttggctgatttactg
aaaataaatagattaccgcaagtttccttaactaaaatattcaggcaatctgaggactca
accattgttacacttgctaaccagattcgccaaggtcgtctaccaactgatttcacagct
aaaaaggccgaccgttcttattttgaagcgcagagcactcacattccgcaaatgattcaa
aagattgtcagttctgcccttaaaagtggtatagatgctcaggaaatacagattttagca
ccgatgtatcgtgggcaagcaggtattacgcatcttaataaactgatgcaagatttgctc
aatcctttaaataaccagttagaatttcaatttaatgaccttcattttcgtaagggcgat
aaagtacttcatcttatcaacgatgcgcaaattaacgtgtttaatggtgacattgggtac
attactgatcttattcctgcaaaatatacagagtccaaacaagatgaaatgattctggat
tttgatggaactgagattaactatcctcgcaatgaatggttgaaaataacactcgcttac
gctatgagtatccacaaatctcaaggcagtgaatttaaagtagttattcttcctgtcaca
cgccaaagcggcagacttttgcagcgcaatctcatttatacagctatcacacgctcaaaa
agcaaacttgttatgttgggagaaattgcagcctttgacaacgccatcaaaaatgaagga
actaaaagaaaaacttatcttattgaacgctttaagaaggatgaatgcagtggccaccat
aacaccgagaaaaataaacaaggagtaaaagaaagtgcagctatattaaaagaagatttt
attttgacagaaagaaatatcttaacgattgaccctatgattggcttatctcaagctgac
attgacttattttttaagaaataa

DBGET integrated database retrieval system