KEGG   Streptococcus mutans NN2025: SmuNN2025_0275Help
Entry
SmuNN2025_0275    CDS       T01185                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
smc  Streptococcus mutans NN2025
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SmuNN2025_0275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SmuNN2025_0275
  Lipid metabolism
   00071 Fatty acid degradation
    SmuNN2025_0275
  Amino acid metabolism
   00350 Tyrosine metabolism
    SmuNN2025_0275
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SmuNN2025_0275
   00626 Naphthalene degradation
    SmuNN2025_0275
Enzymes [BR:smc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SmuNN2025_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
299311..300360
Genome map
AA seq 349 aa AA seqDB search
MKTAVFVKAGQMAIETIEKPSVIEVDDAIIRVIRACVCGSDLWSYRGDDDKATHSANSGH
EIIGIVDEVGSAINTVKKGDFVIAPFTHGCGHCAACRAGFEGGCQGHDRSTNFSSGYQAE
YVRYAHADWSLVKIPGQPSDYSEGMIASLLALADVMPTGYHAARVANVRKGDTVAVVGDG
AVGLCAVIAAKMRGAKRIIIMSRHKDRQELALEFGATDIVEERGEEGVAKVLELTNGDGV
DAALECVGTQLSTETALAIARPGAAIGRVGVPHTKDINLSDYFFQNAIIAGGPASVTTYD
KSVLLKAVLDGEINPGKVFTQSYSLDDIDQAYKDMQERKTIKSMVVVSK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcagtgtttgtaaaagctggtcaaatggccattgaaactattgagaagcca
agtgttattgaagttgatgatgcgatcatccgtgtcattcgtgcttgtgtctgtggttct
gatctgtggtcttatcgtggagatgatgacaaagctacgcattcagccaactcaggtcac
gaaattatcggaatcgttgatgaagttggctctgctattaatacagtgaaaaaaggagac
tttgttattgcaccattcacgcatggttgcggtcattgtgcagcttgtcgtgctggtttt
gaaggaggttgtcaaggacacgatcggtcaacaaacttttcaagtggttatcaagccgaa
tatgttcgttatgctcatgctgattggtctttagtaaaaattccgggtcaacctagcgat
tattcagaaggcatgattgcttcgcttttagctttggcggatgttatgccaacaggctat
catgcagcacgcgtggccaatgttcgaaagggggatacggttgcagttgttggcgatgga
gcggttggactctgtgctgttatcgcagctaaaatgcgtggagctaaacgtatcattatc
atgagtcgccacaaggatcgtcaggaattggcgttggaatttggcgctactgatattgta
gaagagcgcggcgaagaaggtgtagctaaagttcttgaactgacaaatggcgatggtgtt
gatgccgctcttgaatgtgtcggaactcagctgtctactgaaacagcgttagctattgcc
cgtccaggtgcagctatcggtcgcgtgggtgttccacataccaaagatattaatctttcc
gattacttcttccaaaacgctattattgcaggtggaccagcatcagtaacgacttatgac
aaatcggttcttctcaaggctgttcttgatggtgagattaatccaggaaaggtcttcact
caatcttacagcttagatgatattgatcaagcctataaggatatgcaggagcgcaagacc
attaagtctatggttgtcgttagcaaatga

DBGET integrated database retrieval system