KEGG   Streptococcus mutans NN2025: SmuNN2025_0545Help
Entry
SmuNN2025_0545    CDS       T01185                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smc  Streptococcus mutans NN2025
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
570753..572309
Genome map
AA seq 518 aa AA seqDB search
MIIKKRGDYMEKRASGILMHISSLPGKFGIGTFGQEAYDFVDFLKKTGQTYWQLLPLTTT
SYGDSPYQSFSAVAGNVNFIDFKKLQEAGLLDEDDYNSVSFGEDEEIVDYALLFKVRRPI
LEKAVINFLADKTNLKKLALFEEKNETWLDDYAEFMAIKEHFGNKSLQEWGDKKAIRRDE
ERLVRYRHLLADEISYHKVTQYFFFEQWLALKAYANKNKIKIIGDMPIYVAKDSVEVWTM
PELFKMDDDLQPLSVAGCPPDEFSDEGQLWGNPIYDWKKHRETGFAWWIYRIQESFKIYD
ILRIDHFKGFSDYWEIKGNSKTAKNGSWHPGPGIALFRAVQNVLGDMPIIAEDLGYVDDR
ARQLLKETGFPGMKILEFGFYDLSGRSVDIPHHYVQNSVAYIGTHDNDVVNGWYDRLTVE
QEEFVDAYTNRKPIEPVNQAMLRLLFSTVSNTAILTMQDLLNKPASSRMNTPSTIGGNWQ
WRMRAKDLTQDKIDFLSKLTKLYQRGNEENDTKNKTIQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgataataaaaaagcgaggagactatatggaaaaacgcgcaagtggtatcctgatgcat
atcagttctctaccgggaaaatttggaattggtacttttgggcaggaagcttatgatttt
gttgatttcctaaaaaaaacaggtcaaacatattggcagctcttacccttaacgacaacg
agttatggtgattctccttaccaatctttttctgccgttgctggtaatgtgaattttatt
gattttaagaaattacaagaagctggcttattggacgaggatgactataattctgtttct
tttggagaagacgaagaaattgttgattatgctctattatttaaagtacgtcggccaatt
ttggaaaaggctgttatcaattttctggcagacaagactaatctgaaaaaattagctttg
tttgaagaaaaaaatgaaacttggcttgatgactatgctgaatttatggctatcaaggag
cattttggcaataagtctttgcaagagtggggcgataaaaaggctattcgccgtgatgag
gagcgtttggtacgttatcgtcatttgttggccgatgaaattagctaccataaggttaca
cagtacttcttcttcgaacaatggctggcgctgaaagcttatgctaataaaaataagatc
aaaattattggcgatatgcctatctatgtagctaaagacagtgttgaagtctggactatg
cctgaactctttaagatggatgatgacttgcagcctttgtcggttgctggctgtccgccc
gatgaatttagtgatgagggtcagttgtggggaaatcctatttatgattggaaaaagcat
cgagaaacaggctttgcttggtggatttatcgtattcaagaaagttttaagatctatgat
atcttacggatagatcactttaaaggtttctcagattattgggaaattaaaggtaattcc
aaaactgcaaaaaatggcagctggcatccaggacctggtattgctctctttagggctgtt
caaaatgttttgggcgatatgccaattattgcagaggatttgggttacgtagatgataga
gccagacagcttctaaaagaaacaggctttccaggcatgaaaattttagaatttggtttc
tatgatttaagcggccgcagtgttgatattccccaccattatgttcaaaatagtgttgct
tatattgggacgcatgataatgatgttgtcaatggttggtatgatcgtcttactgttgag
caagaagaatttgtggatgcttatactaatcgtaagccaattgagccggttaatcaggct
atgcttagactgctcttttcaactgtcagcaatacagctattttaaccatgcaggatttg
ctcaataagccagccagctctagaatgaataccccatcaacaatcggcggtaactggcaa
tggcggatgagagcaaaagatttaacacaagataaaatagactttttaagtaaattaacg
aaactttatcaaagaggaaatgaagaaaatgacacaaaaaacaaaacaattcagtaa

DBGET integrated database retrieval system