KEGG   Streptococcus mutans NN2025: SmuNN2025_0566Help
Entry
SmuNN2025_0566    CDS       T01185                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smc  Streptococcus mutans NN2025
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SmuNN2025_0566 (glgB)
Enzymes [BR:smc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SmuNN2025_0566 (glgB)
Exosome [BR:smc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SmuNN2025_0566 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594856..596742
Genome map
AA seq 628 aa AA seqDB search
MNEREALRTFGTGENFHAQHYFGFHETEKNGVKGYIFRVWAPNAEDLHLIGDFTGWFDNP
LQMDKNEAGVWEVFTDLPKEGHIYKYLVKRQGGQIVEKMDPFAIYLEERPGTGSLIRTIP
EKKWKDGLWLGRRKRWGFFKRPVNIYEVHAGSWKQNEDGSPYSFEQLKDELVPYLVKMNY
THVEFMPLMAHPLGMSWGYQLMGFFAFEHTYGTPEQFQDFVEACHLNNIGVIVDWVPGHF
TQNDDALAYFDGTPTFEYQDHDRAHNYRWGALNFDLGKNQVQSFLISSAKFWIDFYHIDG
IRVDAVSNMLYLDYDEGPWQPNIEGNNRNLEGYYFLQRLNTVLKLAHPDVMMIAEESTAT
TKITGRREEGGLGFDYKWNMGWMNDILKFYEEDPIYRKYDFNLVTFSFMYLFSENFILPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEFGQFLEWKYDHA
LEWTNLEEEDGLNLKMQDFTSQLNQFYKDHKVLWQLDTSYDGLEIIDADNVDESVLSFIR
KNEKGDLLVCVFNMVPVERKGFTIGVPVAGIYEEVWNTELEEFGGVWKEHNMTVKTQKNL
WKEYENTLSFTLPALGASIWKIKRRLKK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagagagaagcactcagaacatttggaactggagaaaactttcatgcacaacac
tactttggatttcatgaaactgaaaaaaatggcgtaaagggttatattttcagggtttgg
gcgccaaatgctgaggatcttcatcttattggtgactttactggctggtttgataatccc
ttacaaatggataaaaatgaggcaggcgtttgggaagtctttacggatttacctaaggaa
ggccatatatataaataccttgtgaagcgacaaggtgggcaaattgttgaaaagatggat
ccatttgctatttatttggaagagcgtccgggaacgggttctctcatcagaaccattcct
gaaaagaaatggaaagatggtctttggttgggccgccgtaaacgctggggattctttaaa
aggccagtcaatatttatgaagttcatgcgggttcttggaagcaaaatgaagatggaagt
ccctatagctttgaacaattaaaggatgaattggttccttacttagtaaagatgaattat
acacatgttgaattcatgcctttgatggctcatcctttgggcatgagctggggctatcaa
ttgatgggcttctttgcctttgagcacacctatggtactccagaacagtttcaggatttt
gttgaagcctgccatcttaataatattggtgtcattgttgactgggtgcctggtcacttt
acacaaaacgatgatgctctggcttattttgatgggacaccgacctttgagtatcaggat
catgaccgtgcccataattatcgttggggagctcttaattttgatttgggtaaaaatcaa
gttcaatctttcttgatttctagtgctaaattttggatagatttctatcatattgatggt
attcgtgttgatgctgtcagcaatatgctctatttggattatgacgaagggccttggcag
cctaacatagaaggtaacaatcgcaatctagaaggttattattttttgcagcgtttaaat
acagtgctcaaattagctcatccagatgtaatgatgattgcagaagagtcaacagctaca
actaagattacgggcaggcgtgaagaaggtggtctgggatttgactataaatggaatatg
ggttggatgaatgatattttgaaattctatgaagaagatccaatttatcgcaaatacgat
tttaaccttgtgacgtttagttttatgtatctcttttccgaaaattttatcttaccattt
tcacatgatgaagttgtgcacggcaaaaagagtctgatgcataaaatgtggggggatcgt
tataatcaatttgctggtctgagaaatttatatacttatcaaatctgccatcctggtaaa
aaactgctctttatgggaagtgaatttggccaattcttggaatggaaatatgaccatgcc
cttgagtggactaatcttgaggaagaggacggacttaatcttaaaatgcaagattttacc
agccaactcaatcaattttataaagatcataaggtactctggcaattggacaccagttat
gatggtttagaaattattgatgctgataatgttgatgaaagtgtcttgtcttttatcaga
aaaaatgagaagggagatctattagtctgtgtcttcaatatggttcctgtggaacgcaaa
ggttttacaataggcgttccggttgcgggtatatatgaagaagtatggaatactgaactt
gaggaatttggtggagtttggaaagagcacaatatgacagtcaaaacacaaaaaaatttg
tggaaggaatatgaaaatacgctcagcttcactttgccagccttgggtgctagtatttgg
aaaataaaacgtcgtttgaaaaagtaa

DBGET integrated database retrieval system