KEGG   Streptococcus mutans NN2025: SmuNN2025_0647Help
Entry
SmuNN2025_0647    CDS       T01185                                 

Gene name
rmlC
Definition
dTDP-4-keto-L-rhamnose reductase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smc  Streptococcus mutans NN2025
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SmuNN2025_0647 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SmuNN2025_0647 (rmlC)
Enzymes [BR:smc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SmuNN2025_0647 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683780..684376
Genome map
AA seq 198 aa AA seqDB search
MTEEQFFGKELAACKIDAIPGMIEFDIPVHGDNRGWFKENFQKEKMVPLGFPESFFAEGK
LQNNVSFSRKNVLRGLHAEPWDKYISVADEGKVLGSWVDLREGDSFGHVYQTVIDASKGI
FVPRGVANGFQVLSDKVSYSYLVNDYWALELKPKYAFVNYADPTLGIEWENLAEAQVSEA
DKNHPLLKDVKPLKAEDL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaacaattttttggcaaggaattagcagcatgcaagattgatgctattcct
ggaatgattgaatttgatattccagtccacggcgataaccgcggttggtttaaagaaaat
tttcaaaaggaaaaaatggtgccgctaggttttccagaaagcttctttgcagaaggcaaa
ttgcaaaataatgttagtttttcccgtaaaaatgttttacgcggtctgcatgcagaacca
tgggataaatacatttcagtagcggacgagggaaaggttctcggttcttgggttgatctg
cgtgaaggcgatagttttggtcatgtttaccagacagttattgatgcttccaagggtatc
tttgttccccgcggtgtggctaatggtttccaagtcttatctgacaaggtttcttacagt
tatctcgttaatgattactgggcgcttgaactcaaaccaaaatacgctttcgtcaactat
gctgatccaacattaggaattgaatgggaaaatctagcagaagcgcaagtctcagaagcg
gataaaaaccacccattgctcaaagatgttaaaccattaaaagcagaagatttgtga

DBGET integrated database retrieval system