KEGG   Streptococcus mutans NN2025: SmuNN2025_0680Help
Entry
SmuNN2025_0680    CDS       T01185                                 

Gene name
pdhC
Definition
(GenBank) putative dihydrolipoamide acetyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smc  Streptococcus mutans NN2025
Pathway
smc00010  Glycolysis / Gluconeogenesis
smc00020  Citrate cycle (TCA cycle)
smc00620  Pyruvate metabolism
smc01100  Metabolic pathways
smc01110  Biosynthesis of secondary metabolites
smc01120  Microbial metabolism in diverse environments
smc01130  Biosynthesis of antibiotics
smc01200  Carbon metabolism
Module
smc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SmuNN2025_0680 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SmuNN2025_0680 (pdhC)
   00620 Pyruvate metabolism
    SmuNN2025_0680 (pdhC)
Enzymes [BR:smc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SmuNN2025_0680 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N NQRA HlyD_D23 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: BAH87706
Position
722391..723644
Genome map
AA seq 417 aa AA seqDB search
MATEIVMPKLGLTMTEGLINQWLVKEGDTVAAGDPVLEISSEKLTSEVEAPEAGVILKIV
KGEGETVPCKQIIAWIGQEGEAVPDAAGDAPEVDTEAESEVASAGQTVVPEESRTVSAAP
VAEKHEDRRIFITPLARKIAKEKGLDITYIKGTGGNGRITRRDVEAFNPASIPTAEPVTT
LSAPTNVNYGVGLTGMRKVIAERMMSSIHSSAQLTLHRKADVTPLMAFRQDIKTKVNAPL
ENGEIGITTLLTKAVTKALKDYPEANAWYAGGQYEEKEDIHIGMATALSDGLVVPVIRHA
DKLTLSDLGRTIKEEAEQARKGTLDPFLYSGSTFSITNLGAQGIEYFTPILNAPEVAILG
VGAIQKALTLDENGQVAEKQFLPLSLTFDHQVLDGAPAAEFLGAVISYLEDAYSLVF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaaatcgtgatgcctaaattaggtttaaccatgacagaagggctaattaac
caatggctcgttaaagaaggcgacacagttgcagctggcgatcccgtgttggaaattagt
tctgaaaagttaacaagtgaagttgaagctccagaagctggtgttattttaaaaatagtt
aagggagaaggtgagactgttccttgtaaacaaatcattgcttggattggtcaagaaggt
gaggctgttcctgacgctgcaggtgacgctccagaagtagatacagaagctgaaagtgaa
gttgcttcagcagggcaaacagtagttccagaagaaagcaggactgtttcagcagcaccc
gttgctgaaaagcatgaagacagacggatttttatcacaccgctggcccgaaagattgcc
aaggaaaaagggctagacattacttatatcaaaggaacaggcggtaacggacgtatcaca
cgccgtgacgttgaagcctttaatcctgctagcattcctacagctgaacctgtaacaact
ttaagtgctccaacaaatgtaaactatggtgttggtttaacaggtatgcgcaaagtcatt
gctgagcgcatgatgagtagtatccattctagtgctcaattaacgcttcatcgaaaggca
gatgttacgcctttaatggctttcaggcaagatataaaaactaaggttaatgcaccgctt
gaaaacggggaaattggcattacaaccttattgaccaaagcagtaacgaaggctttgaaa
gattatcctgaagcgaatgcttggtatgcaggcggtcaatatgaagaaaaagaagatatt
catattggtatggcaactgctttgagtgatggtttggtcgttcctgttattcgtcatgct
gataaattaacgctgtcagatttgggacgaactattaaagaagaagcagaacaagcacgt
aaaggaactctggatccattcttgtattcaggttccacattctctattaccaatctaggt
gctcaaggcattgaatactttacaccgattttgaatgcacctgaagttgctatcttaggt
gttggagctatccagaaagctttgactcttgatgagaatggtcaagtagctgaaaaacaa
tttttaccacttagtttgacctttgaccatcaagtcttagatggtgcaccagcagctgaa
tttttaggagctgttatctcctacttggaagatgcttatagtctggtattctaa

DBGET integrated database retrieval system