KEGG   Streptococcus mutans NN2025: SmuNN2025_0855Help
Entry
SmuNN2025_0855    CDS       T01185                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smc  Streptococcus mutans NN2025
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SmuNN2025_0855 (pfkA)
   01230 Biosynthesis of amino acids
    SmuNN2025_0855 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SmuNN2025_0855 (pfkA)
   00030 Pentose phosphate pathway
    SmuNN2025_0855 (pfkA)
   00051 Fructose and mannose metabolism
    SmuNN2025_0855 (pfkA)
   00052 Galactose metabolism
    SmuNN2025_0855 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SmuNN2025_0855 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SmuNN2025_0855 (pfkA)
Enzymes [BR:smc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SmuNN2025_0855 (pfkA)
Protein phosphatases and associated proteins [BR:smc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SmuNN2025_0855 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892990..894003
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAISEGMEVCGINRGYAGMVEGDIFPLDAKGVSNI
LSRGGTFLQSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVNTATDALDKIRDTSFSHGRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEPYDIKEVVANVKNGYLSKSKNHHLIVLAEGVMHGEEFAAQMKEAGD
NSDLRVTNLGHILRGGAPTPRDRVIASWMGAHAVELLREGKGGLAIGIQNEELVEHPILG
SAEDGALFSLTEQGGIVVNNPHKARLDFAALNRDLSN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagacgctcctggtatgaatgctgccgtt
cgtgcagtcgttcgtaaagcaatttctgaaggaatggaagtttgcggaatcaatcgtggt
tatgctggtatggttgaaggagatatcttcccgcttgacgctaaaggtgtatcaaacatc
ctttctcgtggagggacatttctccagtccgcacgttaccctgaatttgcaaagcttgaa
gggcaattaaagggtatcgagcaactcaaaaagcatggcattgaaggagtcgttgttata
ggcggcgatggttcttatcatggtgcgatgcgcttgactgagcatggttttcctgctgtc
ggtcttccgggtacaattgataacgatatcgtaggaactgattatacaattggttttgat
actgcagtaaacactgctacggatgcacttgataaaattcgtgatacctcatttagtcac
ggcagaacttttgttgttgaggttatgggacgtaatgcaggagatattgctctttggtct
ggtattgctgccggtgctgaccaaattattattcctgaagagccctatgatattaaagag
gttgtcgccaatgtgaaaaatggctatcttagtaagtctaaaaaccaccatctcattgtt
cttgccgaaggcgttatgcatggtgaagagtttgctgctcagatgaaggaagcaggagat
aatagtgatcttcgtgttaccaaccttgggcatatcctgcgcggtggtgcaccaactcct
cgtgatcgtgtgattgcttcatggatgggagcccatgccgttgaattgctcagggaagga
aaaggcggtcttgccattggtattcaaaatgaggagttggttgagcatccaattcttgga
tctgcggaagatggtgcactctttagtttaacagaacaaggcgggatcgttgtaaataat
ccgcataaagcacgtcttgattttgctgctttgaatcgtgatttgtccaactaa

DBGET integrated database retrieval system