KEGG   Streptococcus mutans NN2025: SmuNN2025_0855Help
Entry
SmuNN2025_0855    CDS       T01185                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
smc  Streptococcus mutans NN2025
Pathway
smc00010  Glycolysis / Gluconeogenesis
smc00030  Pentose phosphate pathway
smc00051  Fructose and mannose metabolism
smc00052  Galactose metabolism
smc00680  Methane metabolism
smc01100  Metabolic pathways
smc01110  Biosynthesis of secondary metabolites
smc01120  Microbial metabolism in diverse environments
smc01130  Biosynthesis of antibiotics
smc01200  Carbon metabolism
smc01230  Biosynthesis of amino acids
smc03018  RNA degradation
Module
smc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SmuNN2025_0855 (pfkA)
   00030 Pentose phosphate pathway
    SmuNN2025_0855 (pfkA)
   00051 Fructose and mannose metabolism
    SmuNN2025_0855 (pfkA)
   00052 Galactose metabolism
    SmuNN2025_0855 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SmuNN2025_0855 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SmuNN2025_0855 (pfkA)
Enzymes [BR:smc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SmuNN2025_0855 (pfkA)
Protein phosphatases and associated proteins [BR:smc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SmuNN2025_0855 (pfkA)
Messenger RNA biogenesis [BR:smc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SmuNN2025_0855 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: BAH87881
Position
892990..894003
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAISEGMEVCGINRGYAGMVEGDIFPLDAKGVSNI
LSRGGTFLQSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVNTATDALDKIRDTSFSHGRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEPYDIKEVVANVKNGYLSKSKNHHLIVLAEGVMHGEEFAAQMKEAGD
NSDLRVTNLGHILRGGAPTPRDRVIASWMGAHAVELLREGKGGLAIGIQNEELVEHPILG
SAEDGALFSLTEQGGIVVNNPHKARLDFAALNRDLSN
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagacgctcctggtatgaatgctgccgtt
cgtgcagtcgttcgtaaagcaatttctgaaggaatggaagtttgcggaatcaatcgtggt
tatgctggtatggttgaaggagatatcttcccgcttgacgctaaaggtgtatcaaacatc
ctttctcgtggagggacatttctccagtccgcacgttaccctgaatttgcaaagcttgaa
gggcaattaaagggtatcgagcaactcaaaaagcatggcattgaaggagtcgttgttata
ggcggcgatggttcttatcatggtgcgatgcgcttgactgagcatggttttcctgctgtc
ggtcttccgggtacaattgataacgatatcgtaggaactgattatacaattggttttgat
actgcagtaaacactgctacggatgcacttgataaaattcgtgatacctcatttagtcac
ggcagaacttttgttgttgaggttatgggacgtaatgcaggagatattgctctttggtct
ggtattgctgccggtgctgaccaaattattattcctgaagagccctatgatattaaagag
gttgtcgccaatgtgaaaaatggctatcttagtaagtctaaaaaccaccatctcattgtt
cttgccgaaggcgttatgcatggtgaagagtttgctgctcagatgaaggaagcaggagat
aatagtgatcttcgtgttaccaaccttgggcatatcctgcgcggtggtgcaccaactcct
cgtgatcgtgtgattgcttcatggatgggagcccatgccgttgaattgctcagggaagga
aaaggcggtcttgccattggtattcaaaatgaggagttggttgagcatccaattcttgga
tctgcggaagatggtgcactctttagtttaacagaacaaggcgggatcgttgtaaataat
ccgcataaagcacgtcttgattttgctgctttgaatcgtgatttgtccaactaa

DBGET integrated database retrieval system