KEGG   Streptococcus mutans NN2025: SmuNN2025_1050Help
Entry
SmuNN2025_1050    CDS       T01185                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethylpteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
smc  Streptococcus mutans NN2025
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SmuNN2025_1050 (folK)
Enzymes [BR:smc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SmuNN2025_1050 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1100047..1100526)
Genome map
AA seq 159 aa AA seqDB search
MTLVYLSLGSNIGERQTYLQRALEELAHLSHITLQAVSPIYETAAWGKTDQADFLNIVCQ
LETDLSPYDLLEACQKIEKHLNRVRHEHWGPRTIDIDILFYGNTIIKEDNLKIPHPYLQN
RAFVLVPLNDIASELVHPVLKETVAVLLEKVDKSGVKIW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtttatttaagtctaggcagtaacataggagagcggcagacttatttgcag
agagctttagaggaactggctcatctctctcatattactttacaggcagtgtcccctatc
tatgaaacagcggcctggggaaagacagatcaagctgattttttaaatattgtttgtcaa
ctcgaaactgatttatcaccatacgatttactagaggcttgtcaaaaaattgaaaaacat
ttaaatcgtgtccgtcatgaacattggggtcccagaacaattgatattgatatcttattt
tatggaaatactattattaaagaggataacctcaaaatcccccatccctatttgcagaat
cgtgcttttgttttggttcctcttaatgatattgccagtgaattagttcatccggtttta
aaggaaacggtagctgttttgctggaaaaagtggacaaatcaggagttaaaatctggtag

DBGET integrated database retrieval system