KEGG   Streptococcus mutans NN2025: SmuNN2025_1133Help
Entry
SmuNN2025_1133    CDS       T01185                                 

Gene name
gtfA
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
smc  Streptococcus mutans NN2025
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SmuNN2025_1133 (gtfA)
Enzymes [BR:smc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SmuNN2025_1133 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1190085..1191587)
Genome map
AA seq 500 aa AA seqDB search
MAVIFRLNWYKPKLIRGDKMPITNKTMLITYADSLGKNLKELNENIENYFGDAVGGVHLL
PFFPSTGDRGFAPIDYHEVDSAFGNWDDVKRLGEKYYLMFDFMINHISRQSKYYKNYQEK
HEASAYKDLFLNWDKFWPKNRPTQEDVDLIYKRKDRAPKQEIQFADGSVEHLWNTFGEEQ
IDLDVTKEVTMDFIRSTIENLAANGCDLIRLDAFAYAVKKLDTNDFFVEPEIWTLLDKVR
DIAAVSGAEILPEIHEHYTIQFKIADHDYYVYDFALPMVTLYSLYSSKVDRLAKWLKMSP
MKQFTTLDTHDGIGVVDVKDILTDEEITYTSNELYKVGANVNRKYSTAEYNNLDIYQINS
TYYSALGDDDQKYFLARLIQAFAPGIPQVYYVGFLAGKNDLELLESTKEGRNINRHYYSS
EEIAKEVKRPVVKALLNLFTYRNQSAAFDLDGRIEVETPNEATIVIERQNKDGSHIAKAE
INLQDMTYRVTENDQTISFE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttatttttaggttgaactggtataaaccaaaattaattagaggagataaaatg
ccaattacaaataaaacaatgttgattacttacgcagacagtttgggtaaaaatttgaaa
gaattgaatgaaaatattgagaattattttggagatgctgttggcggtgtccatttgctg
ccattctttccttccacaggtgatcgtggctttgcaccgattgattaccatgaagttgac
tctgcttttggcaattgggatgatgtcaaacgcttgggtgaaaaatattacctcatgttt
gatttcatgattaatcatatttcgcgtcagtctaaatattataaaaattaccaagaaaag
catgaagcaagtgcttataaagatctatttttaaattgggataaattttggcctaaaaat
cgcccgacacaagaagatgtggacctgatttataagcgtaaggatcgagcacctaagcag
gaaatccaatttgcagatggcagtgttgaacatctctggaacacttttggggaggaacag
attgatcttgacgtgactaaagaagtgactatggattttattcgctctaccattgaaaat
ttagcagccaacggctgtgatctcattcgtttggatgcctttgcttatgctgttaaaaag
ctagatacgaatgatttctttgttgaacctgaaatctggactctgctagataaagttcgt
gatatagctgctgtatcgggtgcggaaatcttgccggaaattcatgaacactatactatt
caatttaaaattgcagaccatgattactatgtttatgattttgccctgcctatggtgacg
ctctacagcctatattcgagcaaggttgaccgtcttgccaaatggctgaaaatgagtccg
atgaaacagttcaccacccttgatacacatgacggtattggtgtggttgatgttaaggat
atcctgactgacgaagaaattacctatacttctaatgagctttataaggtcggtgccaat
gtcaatcgtaagtattcaactgccgaatataataacttggatatctatcaaattaattca
acttactattcagcacttggtgatgatgatcaaaaatactttttggcccgcttgatacaa
gcttttgctccaggtattccacaggtttattacgttggctttttagctggcaagaatgat
cttgaattactggaaagcactaaagaaggccgcaatatcaaccgtcattattatagtagt
gaagaaattgctaaggaagtgaagcgaccagttgtcaaggcacttttaaatctctttact
taccgcaatcagtcagcagcttttgatttggatggccgtattgaagtggaaacgccaaat
gaagcgaccattgtcatagaacgtcaaaataaagatggcagtcatatcgcaaaagcagag
attaatctccaagatatgacatacagagtaacagaaaatgatcaaacaataagctttgaa
taa

DBGET integrated database retrieval system